DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GPA33 and gpa33

DIOPT Version :9

Sequence 1:NP_005805.1 Gene:GPA33 / 10223 HGNCID:4445 Length:319 Species:Homo sapiens
Sequence 2:NP_989326.1 Gene:gpa33 / 394951 XenbaseID:XB-GENE-1014159 Length:332 Species:Xenopus tropicalis


Alignment Length:321 Identity:139/321 - (43%)
Similarity:191/321 - (59%) Gaps:17/321 - (5%)


- Green bases have known domain annotations that are detailed below.


Human     3 GKMWPVLWTLCAVRVTVDAISVETPQDVLRASQGKSVTLPCTYHTSTSSREGLIQWDKLLLTHTE 67
            |:.| |.:.||||..||.||:|:||..::.|::||:.||||||.:.......:|.|.|.   .|:
 Frog     5 GQRW-VPYILCAVLATVSAITVDTPNKIVEAARGKNATLPCTYQSVADKTGSIIGWKKF---DTQ 65

Human    68 RVVIWPFSNKNYIHGELYKNRVSISNNAEQSDASITIDQLTMADNGTYECSVSLMSDLEGNTKSR 132
            ..||..:|..:..:|:.|..|||...:...::..||:.||||.|||||:|.|.:..|.:|...::
 Frog    66 DEVISYYSGGDRTYGDAYTGRVSFIGDPGVNNVGITMTQLTMQDNGTYQCEVIIPKDRKGTPTAK 130

Human   133 VRLLVLVPPSKPECGIEGETIIGNNIQLTCQSKEGSPTPQYSWKRYNILN--QEQPLAQPASGQP 195
            :.|:|||.|:||.|||||.:..|.:|:|.|.|.||||.|.|.|..||..|  ::.||.....|..
 Frog   131 MDLVVLVAPTKPICGIEGTSEYGQDIKLKCNSVEGSPVPDYQWTSYNPQNAPRQLPLTSVREGSD 195

Human   196 VSLKNISTDTSGYYICTSSNEEGTQFCNITVAVRSPSMNVALYVGIAVGVVAALIIIGIIIYCCC 260
            :.|||||.||||||||.|.|:.|.:.|||||.|..||||:.||.||..|.|||:|:|||::||||
 Frog   196 LKLKNISADTSGYYICVSKNKVGEESCNITVVVMPPSMNIGLYAGIIGGGVAAVIVIGILVYCCC 260

Human   261 CRGKDDN-------TEDKEDARPNREAYEEPPEQLRELSREREEEDDYRQEEQRSTGRESP 314
            ||...|.       .:|:|:..|.    ::..:|::...||..::||..||.:|.||...|
 Frog   261 CRDSGDKEDYEMGYRDDEEEVDPR----QQNKQQMQRNQREEYDDDDGYQESKRGTGPPVP 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GPA33NP_005805.1 V-set 26..138 CDD:311561 39/111 (35%)
IGc2 154..218 CDD:197706 33/65 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 267..319 14/55 (25%)
gpa33NP_989326.1 V-set 32..136 CDD:311561 37/106 (35%)
IG_like 153..228 CDD:214653 39/74 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 87 1.000 Domainoid score I32621
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H4245
Inparanoid 1 1.050 264 1.000 Inparanoid score I11175
NCBI 1 1.000 - -
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D240680at32523
OrthoFinder 1 1.000 - - FOG0001092
OrthoInspector 1 1.000 - - oto153999
Panther 1 1.100 - - LDO PTHR44969
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X10293
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.160

Return to query results.
Submit another query.