DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GPA33 and DIP-beta

DIOPT Version :9

Sequence 1:NP_005805.1 Gene:GPA33 / 10223 HGNCID:4445 Length:319 Species:Homo sapiens
Sequence 2:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster


Alignment Length:380 Identity:77/380 - (20%)
Similarity:140/380 - (36%) Gaps:120/380 - (31%)


- Green bases have known domain annotations that are detailed below.


Human    27 PQDVLRASQGKSVTLPCTYHT--------STSSREGLIQWDK-----LLLTHTERVVIWPFSNKN 78
            |.:.:..:||:..|..|..:.        ..||....:.|.|     :|..| |.|:    :|  
  Fly   103 PLENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIH-EHVI----TN-- 160

Human    79 YIHGELYKNRVSISNNAEQSDASITIDQLTMADNGTYECSVSLMSDLEGNT----KSRVRLLVLV 139
                   .:|:|:.:| :.:..::.|..:.|.|.|.|.|.|        ||    .....|.|::
  Fly   161 -------NDRLSVQHN-DYNTWTLNIRGVKMEDAGKYMCQV--------NTDPMKMQTATLEVVI 209

Human   140 PPSKPECGIEGETII--GNNIQLTCQSKEGSPTPQYSWKRYN---IL----NQEQPLAQPASGQP 195
            ||........|:.::  |.:.:|.|::: |.|.|:.:|:|.:   |:    :.::..||...|:.
  Fly   210 PPDIINEETSGDMMVPEGGSAKLVCRAR-GHPKPKITWRREDGREIIARNGSHQKTKAQSVEGEM 273

Human   196 VSLKNISTDTSGYYICTSSN--------------------------------EEGTQFCNITVAV 228
            ::|..|:....|.|:|.:||                                .:.|..||:..:.
  Fly   274 LTLSKITRSEMGAYMCIASNGVPPTVSKRMKLQVHFHPLVQVPNQLVGAPVLTDVTLICNVEASP 338

Human   229 RSPSM----NVALYVGIAVGVVAAL-------IIIGIII------------YCCCCRGKDDNTED 270
            ::.:.    |..:   |..|...||       ..|.:|:            |.|..:....:||.
  Fly   339 KAINYWQRENGEM---IIAGDRYALTEKENNMYAIEMILHIKRLQSSDFGGYKCISKNSIGDTEG 400

Human   271 K----EDARPNREAYEEPPEQLRELSREREEEDDYRQEE--QRSTGR----ESPD 315
            .    |..||.::...:  :.|.|:|:....:.|.|.|:  :...||    .:||
  Fly   401 TIRLYEMERPGKKILRD--DDLNEVSKNEVVQKDTRSEDGSRNLNGRLYKDRAPD 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GPA33NP_005805.1 V-set 26..138 CDD:311561 27/127 (21%)
IGc2 154..218 CDD:197706 19/104 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 267..319 15/59 (25%)
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 28/128 (22%)
ig 102..195 CDD:278476 24/114 (21%)
IG_like 219..307 CDD:214653 20/88 (23%)
Ig 221..307 CDD:299845 19/86 (22%)
Ig 311..404 CDD:299845 14/95 (15%)
IG_like 327..405 CDD:214653 14/80 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.