DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GDF11 and scw

DIOPT Version :9

Sequence 1:NP_005802.1 Gene:GDF11 / 10220 HGNCID:4216 Length:407 Species:Homo sapiens
Sequence 2:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster


Alignment Length:370 Identity:86/370 - (23%)
Similarity:136/370 - (36%) Gaps:74/370 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    88 RLKEAPNISREVVKQLLPKAPPLQQILD----LHDFQGDALQPEDFL---EEDEYHATTETVISM 145
            |.:..||:.....|.||.....:.:..:    ||.....:|. :|.|   |:.:..|:..::::.
  Fly    53 RRQAEPNLHNSASKFLLEVYNEISEDQEPKEVLHQRHKRSLD-DDILISNEDRQEIASCNSILTF 116

Human   146 AQETDPAVQTDGSPLCCHFHFSPK--VMFTKVLKAQLWVYLRP--VPRPATVYLQILRLKPLTGE 206
            :....|. |.| :.|..|..|:..  .:...:::|.|.:|.:|  |.|.|...:.:.|..     
  Fly   117 SSRLKPE-QLD-NELDMHITFNTNDVPVDLSLVQAMLRIYKQPSLVDRRANFTVSVYRKL----- 174

Human   207 GTAGGGGGGRRHIRIRSL-KIELHSRSGHWQSIDFKQVLHSWFRQPQSNWGIE------INAFDP 264
                   ..|:....|.| .:...|....|...:....|..|..    |.|::      |:..|.
  Fly   175 -------DNRQDFSYRILGSVNTTSSQRGWLEFNLTDTLRYWLH----NKGLQRRNELRISIGDS 228

Human   265 SGTDLAV---------TSLGP-------GAEGLHPFMELRVLENTKRSRRNLGL-------DCDE 306
            ..:..|.         |||.|       |.|.|....:||...:.::.|...|.       ..|.
  Fly   229 QLSTFAAGLVTPQASRTSLEPFIVGY
FNGPELLVKIQKLRFKRDLEKRRAGGGSPPPPPPPPVDL 293

Human   307 HSSESRCCRYPLTVDF-EAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHT---------HLVQQ 361
            :.....|.|...|||| |....:|:||||:::|.:|.|.|.:....|...|         ||.|.
  Fly   294 YRPPQSCERLNFTVDFKELHMHNWVIAPKKFEAYFCGGGCNFPLGTKMNATNHAIVQTLMHLKQP 358

Human   362 ANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGC 406
            ..|:    |||.||.:..|.:|.:.::..|...|....|...|||
  Fly   359 HLPK----PCCVPTVLGAITILRYLNEDIIDLTKYQKAVAKECGC 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GDF11NP_005802.1 TGFb_propeptide 61..285 CDD:366248 46/230 (20%)
TGF_beta_GDF8 301..407 CDD:381658 37/123 (30%)
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 43/219 (20%)
TGFB 300..400 CDD:214556 35/104 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.