DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDK7 and Pk34A

DIOPT Version :9

Sequence 1:NP_001790.1 Gene:CDK7 / 1022 HGNCID:1778 Length:346 Species:Homo sapiens
Sequence 2:NP_609603.1 Gene:Pk34A / 34705 FlyBaseID:FBgn0028410 Length:392 Species:Drosophila melanogaster


Alignment Length:342 Identity:108/342 - (31%)
Similarity:161/342 - (47%) Gaps:44/342 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    11 RYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQEL-SHPNI 74
            |.|..|.:|.|.|..||:|....:.:|||:|:..  :..:...|       |.:::.:| .|.||
  Fly    43 RIEVKDLIGSGSFGRVYQAHVNESEEIVAVKQTL--YNPKLSQG-------EAEIMGQLKDHNNI 98

Human    75 IGLLD------AFGHKSNISLVFDFMETDLEVIIKDNSLVLTPS----HIKAYMLMTLQGLEYLH 129
            :.|:.      .|.....:.||.::|...|...|..:..||.|:    :::.......:||.|||
  Fly    99 VRLIMHSSVSLGFPSVDYVLLVMEYMPMTLLDYINYHLTVLQPAERLINVRILSYQMFRGLGYLH 163

Human   130 QHWILHRDLKPNNLLLD-ENGVLKLADFGLAKSF--GSPNRAYTHQVVTRWYRAPELLFGARMYG 191
            ...|.|||:||.|||:| :..||||:|||.||..  ..|:.:|   :.:|.||||||..|..:|.
  Fly   164 LLGISHRDVKPENLLIDNQKMVLKLSDFGSAKLLVPQEPSISY---ICSRLYRAPELFAGYELYS 225

Human   192 VGVDMWAVGCILAELLLRVP-FLPGDSDLDQLTRIFETLGTPTEEQWPDM---C--SLPDYVTFK 250
            ..||:|:.||:|||||...| |.....|..||..|...|||...|:.|::   |  ||....|..
  Fly   226 CAVDIWSAGCVLAELLKGYPLFSSHKHDRKQLRLIVNMLGTDGLERAPEILSKCGNSLHPRTTRP 290

Human   251 SFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQAL------KMKYFSNRPGPTP-GCQLP 308
            |:.    :.:.:|...||..|:...|::...|||:...|.      :::.......|.| |..||
  Fly   291 SWN----YLLNTAVPQDLCGLLNSCFIYEAAARISPMMACSHGSYDELRIMDAMALPMPNGNPLP 351

Human   309 RPNCPVETLKEQSNPAL 325
             |.....:|:..::|.|
  Fly   352 -PLFDFNSLEMGTDPKL 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDK7NP_001790.1 STKc_CDK7 11..308 CDD:270833 102/323 (32%)
Pk34ANP_609603.1 STKc_GSK3 39..334 CDD:271039 99/306 (32%)
S_TKc 45..328 CDD:214567 98/298 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.