DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDK7 and Cdk7

DIOPT Version :9

Sequence 1:NP_001790.1 Gene:CDK7 / 1022 HGNCID:1778 Length:346 Species:Homo sapiens
Sequence 2:NP_511044.1 Gene:Cdk7 / 31441 FlyBaseID:FBgn0263237 Length:353 Species:Drosophila melanogaster


Alignment Length:349 Identity:231/349 - (66%)
Similarity:278/349 - (79%) Gaps:7/349 - (2%)


- Green bases have known domain annotations that are detailed below.


Human     1 MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKL 65
            |..:...:.:||.||.|||||||||||||||..||||||:||||.|.|.:|:||||||||||||:
  Fly     1 MLPNANDKTERYAKLSFLGEGQFATVYKARDTVTNQIVAVKKIKKGSREDARDGINRTALREIKI 65

Human    66 LQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQ 130
            ||||.|.|||||:|.||..||:|||||||:||||||||||.::||.::||||.:|||:||||||.
  Fly    66 LQELQHENIIGLVDVFGQLSNVSLVFDFMDTDLEVIIKDNKIILTQANIKAYAIMTLKGLEYLHL 130

Human   131 HWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVD 195
            :|||||||||||||::.:|:||:.|||||||||||||.|||.|||||||:||||||||.||.|||
  Fly   131 NWILHRDLKPNNLLVNSDGILKIGDFGLAKSFGSPNRIYTHHVVTRWYRSPELLFGARQYGTGVD 195

Human   196 MWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHI 260
            |||||||||||:|||||:|||||||||||||.|||||||.:||.:..|.||:.|::|||.||.:|
  Fly   196 MWAVGCILAELMLRVPFMPGDSDLDQLTRIFSTLGTPTEAEWPHLSKLHDYLQFRNFPGTPLDNI 260

Human   261 FSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPAL 325
            |:|||:||:.|:|.||..||..|::..:||.|.||:|:|.||.|.:||.|:. :...||.:||..
  Fly   261 FTAAGNDLIHLMQRLFAMNPLRRVSCREALSMPYFANKPAPTVGPKLPMPSA-ILAAKEGANPQT 324

Human   326 -----AIKRKRTEALEQG-GLPKK 343
                 |:|||..|...:| ||.:|
  Fly   325 GDTKPALKRKLVETTVRGNGLAQK 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDK7NP_001790.1 STKc_CDK7 11..308 CDD:270833 214/296 (72%)
Cdk7NP_511044.1 PTZ00024 6..308 CDD:240233 214/301 (71%)
STKc_CDK7 11..308 CDD:270833 214/296 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143676
Domainoid 1 1.000 440 1.000 Domainoid score I555
eggNOG 1 0.900 - - E1_KOG0659
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1363
Inparanoid 1 1.050 470 1.000 Inparanoid score I1530
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1367115at2759
OrthoFinder 1 1.000 - - FOG0003675
OrthoInspector 1 1.000 - - oto88653
orthoMCL 1 0.900 - - OOG6_103547
Panther 1 1.100 - - LDO PTHR24056
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R249
SonicParanoid 1 1.000 - - X2548
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.