DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ANGPTL7 and CG31832

DIOPT Version :9

Sequence 1:NP_066969.1 Gene:ANGPTL7 / 10218 HGNCID:24078 Length:346 Species:Homo sapiens
Sequence 2:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster


Alignment Length:207 Identity:77/207 - (37%)
Similarity:117/207 - (56%) Gaps:14/207 - (6%)


- Green bases have known domain annotations that are detailed below.


Human   142 SGVYKLPPDDFLGSPELEVF--CDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWL 204
            :|:::|.      .||.|.|  ...:|:...|.:||||..|.|:|.:.|..||.|||...|:|::
  Fly    31 NGIHQLM------LPEEEPFQVTQCKTTARDWIVIQRRLDGSVNFNQSWFSYKDGFGDPNGEFFI 89

Human   205 GNEHIHRLSR-QPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRL-FLGNYTGNVGNDALQYHN 267
            |.:.::.::| ||..|.::::...|...||.:..|.:.:|...|:| .:|.|:|..| |:|:||.
  Fly    90 GLQKLYLMTREQPHELFIQLKHGPGATVYAHFDDFQVDSETELYKLERVGKYSGTAG-DSLRYHI 153

Human   268 NTAFSTKDKDNDNCLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHNKHLDGITWYGWHGSTYSL 332
            |..|||.|:|||.....||....||:|::.|..|:|||:|:|.||... |:||.|..|  ...||
  Fly   154 NKRFSTFDRDNDESSKNCAAEHGGGWWFHSCLSSSLNGLYFREGETGM-LNGIHWGRW--KFQSL 215

Human   333 KRVEMKIRPEDF 344
            ..|::.|||:.|
  Fly   216 TFVQIMIRPKYF 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ANGPTL7NP_066969.1 SMC_N <37..>109 CDD:330553
FReD 129..341 CDD:238040 74/202 (37%)
CG31832NP_723894.2 FReD 28..225 CDD:238040 75/203 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.