DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CTDSPL and hzg

DIOPT Version :9

Sequence 1:XP_016861008.1 Gene:CTDSPL / 10217 HGNCID:16890 Length:297 Species:Homo sapiens
Sequence 2:NP_001261912.1 Gene:hzg / 39748 FlyBaseID:FBgn0036556 Length:352 Species:Drosophila melanogaster


Alignment Length:300 Identity:170/300 - (56%)
Similarity:204/300 - (68%) Gaps:45/300 - (15%)


- Green bases have known domain annotations that are detailed below.


Human     1 MDGPAIITQVTNPKEDEGR---------------------LPGAGEKASQC--NVSLKKQRSRSI 42
            ||..:|||||:  ::||..                     ||......:|.  :|...|.:.|.:
  Fly     1 MDATSIITQVS--RDDEQLNVYPSYPNDKDAWLGFSGSVWLPDCPADHAQLTHDVDRLKPQKRGL 63

Human    43 LSSFFCCFRDYNVEAPPPSSPSVLPPLVEENGGLQKGDQRQVIPIPSP-PAKYLLPEVTVLDYGK 106
            ..|..||:|....:             ..:||....|   ...|.|.| ..:||||:|.:.|..:
  Fly    64 FHSLLCCWRRNRTK-------------TNQNGTQIDG---STTPPPLPDQQRYLLPQVRLTDMHR 112

Human   107 KCVVIDLDETLVHSSFKPISNADFIVPVEIDGTIHQVYVLKRPHVDEFLQRMGQLFECVLFTASL 171
            ||:||||||||||||||||.|||||||||||||:||||||||||||||||:||:|:|||||||||
  Fly   113 KCMVIDLDETLVHSSFKPIPNADFIVPVEIDGTVHQVYVLKRPHVDEFLQKMGELYECVLFTASL 177

Human   172 AKYADPVADLLDRWGVFRARLFRESCVFHRGNYVKDLSRLGRELSKVIIVDNSPASYIFHPENAV 236
            ||||||||||||:|.||||||||||||::||||:|||:||||:|.|::|||||||||||||:|||
  Fly   178 AKYADPVADLLDKWNVFRARLFRESCVYYRGNYIKDLNRLGRDLQKIVIVDNSPASYIFHPDNAV 242

Human   237 PVQSWFDDMTDTELLDLIPFFEGLSREDDVYSMLHRLCNS 276
            ||:|||||:||.||.:|||.||.||:.|.|||:   ||||
  Fly   243 PVKSWFDDVTDCELRELIPLFEKLSKVDSVYSV---LCNS 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CTDSPLXP_016861008.1 HIF-SF_euk 106..265 CDD:274055 131/158 (83%)
hzgNP_001261912.1 HIF-SF_euk 112..270 CDD:274055 131/157 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158656
Domainoid 1 1.000 287 1.000 Domainoid score I1592
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 314 1.000 Inparanoid score I2566
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 1 1.000 - - FOG0000901
OrthoInspector 1 1.000 - - otm41140
orthoMCL 1 0.900 - - OOG6_100959
Panther 1 1.100 - - O PTHR12210
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1679
SonicParanoid 1 1.000 - - X485
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.