DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CTDSPL and CG12078

DIOPT Version :9

Sequence 1:XP_016861008.1 Gene:CTDSPL / 10217 HGNCID:16890 Length:297 Species:Homo sapiens
Sequence 2:NP_647795.2 Gene:CG12078 / 38401 FlyBaseID:FBgn0035426 Length:253 Species:Drosophila melanogaster


Alignment Length:195 Identity:66/195 - (33%)
Similarity:106/195 - (54%) Gaps:19/195 - (9%)


- Green bases have known domain annotations that are detailed below.


Human    89 SPPAKYLLPEVTVLDYGKKCVVIDLDETLVHSSF-----KP-----ISNADFIVPVEIDGTIHQV 143
            ||.:|..|..|     .:|.:|:|:|.|::.|.|     ||     |:: ||...:...|.  .:
  Fly    58 SPVSKSRLSLV-----ARKTLVLDMDNTMITSWFIKRGKKPKNIPRIAH-DFKFYLPAYGA--TI 114

Human   144 YVLKRPHVDEFLQRMGQLFECVLFTASLAKYADPVADLLDRW-GVFRARLFRESCVFHRGNYVKD 207
            ||.|||::|.||.|:.:.::..:||:....||.|:.|.|||. |:..:||:|:.|:...|.:.|.
  Fly   115 YVYKRPYLDHFLDRVSKWYDLTVFTSGAEIYASPILDFLDRGRGILNSRLYRQHCIEQFGKWSKS 179

Human   208 LSRLGRELSKVIIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFEGLSREDDVYSMLHR 272
            :.....:||.|:::|||.....|:.|||:.::|:.....|..|::|:||.:.|....||.|||.|
  Fly   180 VLLACPDLSNVVLLDNSSTECSFNAENAILIKSYEIGCRDEALINLLPFLDALRFMKDVRSMLKR 244

Human   273  272
              Fly   245  244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CTDSPLXP_016861008.1 HIF-SF_euk 106..265 CDD:274055 55/169 (33%)
CG12078NP_647795.2 HIF-SF_euk 70..237 CDD:274055 55/169 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.