DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CTDSPL and CG8584

DIOPT Version :10

Sequence 1:NP_001424957.1 Gene:CTDSPL / 10217 HGNCID:16890 Length:297 Species:Homo sapiens
Sequence 2:NP_610404.1 Gene:CG8584 / 35856 FlyBaseID:FBgn0033322 Length:293 Species:Drosophila melanogaster


Alignment Length:184 Identity:71/184 - (38%)
Similarity:107/184 - (58%) Gaps:16/184 - (8%)


- Green bases have known domain annotations that are detailed below.


Human   105 GKKCVVIDLDETLVHSSF--------------KPISNADFIVPVEIDGTIHQVY-VLKRPHVDEF 154
            |:|.:|:|||||||||.:              ...:..|:::.:.|||....|: |.||||||||
  Fly    94 GRKTLVLDLDETLVHSCYLDPDTHDNVGCSQLPEHAQPDYVLNISIDGMEPIVFRVFKRPHVDEF 158

Human   155 LQRMGQLFECVLFTASLAKYADPVADLLDRW-GVFRARLFRESCVFHRGNYVKDLSRLGRELSKV 218
            |..:.:.::.|::||||..||..|.|.||.. |:...|.:|:.|........|||:.:..::|.|
  Fly   159 LDFVSKWYDLVIYTASLEVYAAQVVDHLDAGRGLITRRFYRQHCRASSPMVSKDLTLVTPDMSGV 223

Human   219 IIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFEGLSREDDVYSMLHR 272
            :|:||||.:|...|:||:|::::..|..|||||.::||.:.|....||.|:|.|
  Fly   224 LIIDNSPYAYRDFPDNAIPIKTFIYDPDDTELLKMLPFLDALRFTKDVRSILGR 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CTDSPLNP_001424957.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
CG8584NP_610404.1 HIF-SF_euk 95..270 CDD:274055 65/174 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.