DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CTDSPL and ttm50

DIOPT Version :9

Sequence 1:XP_016861008.1 Gene:CTDSPL / 10217 HGNCID:16890 Length:297 Species:Homo sapiens
Sequence 2:NP_001303557.1 Gene:ttm50 / 31266 FlyBaseID:FBgn0250874 Length:428 Species:Drosophila melanogaster


Alignment Length:250 Identity:70/250 - (28%)
Similarity:111/250 - (44%) Gaps:44/250 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    41 SILSSFFCCFRDYNVEAPPPSSP----SVLPPLVEE------------NGGLQKGDQRQVIPIP- 88
            ::.:.|:..:.....|..|...|    ....|||::            ...:|:..:.:::|.| 
  Fly   156 AVAAGFWAVYEFGKPEVDPNGQPIEDEFTHKPLVQQYLQRMWKSIHYYQRMIQEPSRAKLLPDPL 220

Human    89 SPPAKYLLPEVTVLDYGKKCVVIDLDETLVHSSFKPISNADFIVPVEIDGTIHQVYVLKRPHVDE 153
            .||  |:.|..|        :|:::.:.|||..:...:...|               .|||.||.
  Fly   221 KPP--YVQPRYT--------LVLEMKDVLVHPDWTYQTGWRF---------------KKRPGVDH 260

Human   154 FLQRMGQLFECVLFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYVKDLSRLGRELSKV 218
            ||....:.||.|:|||.......|:.|.||..|....||.|::..|..|::||:|..|.|:|.||
  Fly   261 FLAECAKDFEIVVFTAEQGMTVFPILDALDPNGYIMYRLVRDATHFVDGHHVKNLDNLNRDLKKV 325

Human   219 IIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFEGLSRE--DDVYSMLH 271
            |:||....:...||:|...:..|..:..|.:|||||.|.:.:::.  |||..:||
  Fly   326 IVVDWDANATKMHPDNTFGLARWHGNDDDGQLLDLIAFLKIIAQNNVDDVREVLH 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CTDSPLXP_016861008.1 HIF-SF_euk 106..265 CDD:274055 50/160 (31%)
ttm50NP_001303557.1 CPDc 227..355 CDD:214729 45/150 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.