DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FLOT1 and Flo2

DIOPT Version :9

Sequence 1:NP_005794.1 Gene:FLOT1 / 10211 HGNCID:3757 Length:427 Species:Homo sapiens
Sequence 2:NP_001259553.1 Gene:Flo2 / 32425 FlyBaseID:FBgn0264078 Length:448 Species:Drosophila melanogaster


Alignment Length:443 Identity:185/443 - (41%)
Similarity:281/443 - (63%) Gaps:30/443 - (6%)


- Green bases have known domain annotations that are detailed below.


Human     4 TCGPNEAMVVSGFC--RSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVT 66
            |.|||||::|||.|  .:....:.||..:....:..:||:|||.:|||...|.|.|..|||::||
  Fly     6 TTGPNEALIVSGGCCGSTKKRTIVGGWAWAWWLVTDVQRLSLNVMTLNPMCENVETSQGVPLTVT 70

Human    67 GIAQVKI----------------------QGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQR 109
            |:||.||                      ..|..|:|..|.:.||||:..||....|:|||||.|
  Fly    71 GVAQCKIMKSSSYKQTDYHNDEMMNVYYFHHQADELLGTASEQFLGKSVKEIKQTILQTLEGHLR 135

Human   110 AIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQK 174
            ||:..:||||:||||.:|:..|.:||:.|:..|||.::|:|:||::||..||.|||||:||.|::
  Fly   136 AILGTLTVEEVYKDRDQFAALVREVAAPDVGRMGIEILSFTIKDVYDDVQYLASLGKAQTAVVKR 200

Human   175 DARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQ 239
            ||..|.|||.||||||||:.::..:..:|.::.::....|.|:|:||.:|.|:||.:|::.|||:
  Fly   201 DADAGVAEANRDAGIREAECEKSAMDVKYSTDTKIEDNTRMYKLQKANFDQEINTAKAESQLAYE 265

Human   240 LQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLERLAEAEKSQ 304
            ||.||.:|:|..:.:|::||||.:|:.::.||:.|:::||...|:.|||||.::|:.||:|::.|
  Fly   266 LQAAKIRQRIRNEEIQIEVVERRKQIEIESQEVQRKDRELTGTVKLPAEAEAFRLQTLAQAKQCQ 330

Human   305 LIMQAEAEAASVRMRGEAEAFAIGARARAEAEQMAKKAEAFQLYQEAAQLDMLLEKLPQVAEEIS 369
            .|..|.|||..:|..|.|||.||....:||||:|..||..::.|.:||.::::||.||::|.|::
  Fly   331 TIEGARAEAERIRKIGSAEAHAIELVGKAEAERMRMKAHVYKQYGDAAIMNIVLESLPKIAAEVA 395

Human   370 GPLTSANKITLVSSGSGTMGAAKVTGEVLDILTRLPESVERLTGVSISQVNHK 422
            .||...::|.|:.      |...:|.:|..::.:||.|:..||||.:|:|..|
  Fly   396 APLAKTDEIVLIG------GNDNITNDVTRLVAQLPPSINALTGVDLSKVLSK 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FLOT1NP_005794.1 Flot 4..419 CDD:330594 183/438 (42%)
SPFH_flotillin 30..175 CDD:259798 72/166 (43%)
Flo2NP_001259553.1 SPFH_flotillin 34..201 CDD:259798 72/166 (43%)
PHB 110..281 CDD:214581 82/170 (48%)
SPFH_like <286..374 CDD:302763 38/87 (44%)
Flot 337..>410 CDD:292597 30/78 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2268
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4089
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D340567at33208
OrthoFinder 1 1.000 - - FOG0001627
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.770

Return to query results.
Submit another query.