DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDK6 and msn

DIOPT Version :9

Sequence 1:NP_001138778.1 Gene:CDK6 / 1021 HGNCID:1777 Length:326 Species:Homo sapiens
Sequence 2:NP_524679.3 Gene:msn / 44030 FlyBaseID:FBgn0010909 Length:1504 Species:Drosophila melanogaster


Alignment Length:324 Identity:91/324 - (28%)
Similarity:148/324 - (45%) Gaps:65/324 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    13 YECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIR-EVAVLRHLETFEHPNV 76
            :|.:..:|.|.||:|:|.|..|. |:..|:|.:.|...||    ..|: |:.||:...  .|.|:
  Fly    32 FELIEVVGNGTYGQVYKGRHTKT-GQLAAIKVMDVTEDEE----EEIKLEINVLKKYS--NHRNI 89

Human    77 VRLFDV-CTVSRTDRETKLTLVFEHVDQDLTTYLDKVPE-PGVPTETIKDMMFQLLRGLDFLHSH 139
            ...:.. ...|...::.:|.||.|:......|.|.|..: ..:..|.|..:..::||||.:|||:
  Fly    90 ATYYGAFIKKSPPGKDDQLWLVMEYCGAGSVTDLVKSTKGQSLKEEWIAYICREILRGLSYLHSN 154

Human   140 RVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALT-----SVVVTLWYRAPEVLL-----QS 194
            :|:|||:|.||:|:|.:.::||.|||:    |.|:..|     :.:.|.::.||||:.     .:
  Fly   155 KVIHRDIKGQNVLLTDNAEVKLVDFGV----SAQLDRTIGRRNTFIGTPYWMAPEVIACDENPDA 215

Human   195 SYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSA 259
            :|....||||:|....||...:|..   .|:..:..:..:         ||: :.||    .||.
  Fly   216 TYDNRSDLWSLGITALEMAESQPPL---CDLHPMRALFLI---------PRN-SPPR----LKSK 263

Human   260 QPIEKFVTDIDE-LGKDLLLKCLTFNPAKRISAYSALSHPYFQD--------------LERCKE 308
            :..:||...||. |.||...:..|.|         .|.|.:.:|              ::|||:
  Fly   264 KWSKKFHGFIDTVLVKDYHQRPYTEN---------LLKHGFIKDQPTDRQVRIQLKDHIDRCKK 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDK6NP_001138778.1 STKc_CDK6 11..300 CDD:270846 87/300 (29%)
msnNP_524679.3 STKc_myosinIII_N_like 25..296 CDD:270785 87/300 (29%)
S_TKc 32..296 CDD:214567 87/300 (29%)
CNH 1183..1484 CDD:214481
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.