DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DHRS2 and CG18814

DIOPT Version :10

Sequence 1:NP_878912.1 Gene:DHRS2 / 10202 HGNCID:18349 Length:300 Species:Homo sapiens
Sequence 2:NP_652673.2 Gene:CG18814 / 59175 FlyBaseID:FBgn0042137 Length:267 Species:Drosophila melanogaster


Alignment Length:127 Identity:30/127 - (23%)
Similarity:56/127 - (44%) Gaps:23/127 - (18%)


- Green bases have known domain annotations that are detailed below.


Human   142 LSVNVKSPALLLSQL--LPYME----NRRGAVILVSSIAAYNPVVALGVYNVSKTALLGLTRTLA 200
            |::.:....::.|.|  |.||:    .|.|.::.:||:|...|...:.:|:.|||.:...||.:|
  Fly   101 LTIQINLVGVINSTLTALEYMDKSKGGRGGLIVNISSVAGLQPTPLMAIYSTSKTGVTTFTRAMA 165

Human   201 --LELAPKDIRVNCVVPGIIKTDFSKVV-----------RIGFMGMSLSGRT----SRNIIS 245
              :..|...:....:.||...|...|.:           |:..:...:.|:|    :|||::
  Fly   166 SPIHYAHSGVGFITICPGYTNTGILKDIDKKTTFPFYETRMRTVFSKVKGQTAEVCARNIVN 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DHRS2NP_878912.1 Rossmann-fold NAD(P)(+)-binding proteins 27..>226 CDD:473865 24/91 (26%)
CG18814NP_652673.2 Rossmann-fold NAD(P)(+)-binding proteins 6..248 CDD:473865 30/127 (24%)

Return to query results.
Submit another query.