DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NME6 and CG15547

DIOPT Version :10

Sequence 1:XP_024309067.1 Gene:NME6 / 10201 HGNCID:20567 Length:302 Species:Homo sapiens
Sequence 2:NP_651833.1 Gene:CG15547 / 43661 FlyBaseID:FBgn0039809 Length:390 Species:Drosophila melanogaster


Alignment Length:82 Identity:20/82 - (24%)
Similarity:40/82 - (48%) Gaps:7/82 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    58 TLALIKPDAV--AHPLILEAVHQQILSNKFLIVRMRELLWRKEDCQRFYREHEGRFFYQRLVEFM 120
            :|.:||||.:  ..|::|     ::|:..|.|...|.:.:..|....||.::.....:...|..:
  Fly     5 SLFIIKPDYLHKRRPVLL-----KLLAEGFQIQGNRRIAFSPETAAEFYADYADEKGFMLEVILL 64

Human   121 ASGPIRAYILAHKDAIQ 137
            :.|...|:|:..::|:|
  Fly    65 SKGVSEAFIVTKENAVQ 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NME6XP_024309067.1 NDPk6 56..175 CDD:239877 20/82 (24%)
CG15547NP_651833.1 NDPk 3..119 CDD:469726 20/82 (24%)

Return to query results.
Submit another query.