DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDK5 and CG6800

DIOPT Version :9

Sequence 1:NP_004926.1 Gene:CDK5 / 1020 HGNCID:1774 Length:292 Species:Homo sapiens
Sequence 2:NP_650984.1 Gene:CG6800 / 42562 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster


Alignment Length:291 Identity:112/291 - (38%)
Similarity:163/291 - (56%) Gaps:25/291 - (8%)


- Green bases have known domain annotations that are detailed below.


Human     3 KYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLH 67
            :|:.|||||||.:|.||||.:.:.::.||:|:|.|.:....:..:.||||..|:..|.:.|:.:.
  Fly     8 RYKMLEKIGEGVHGCVFKAIDLQRNKEVAIKKVALKNKFGNIALNTLREIKTLQLCKSEYILDII 72

Human    68 DVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNL 132
            |:......|:||.|:....|.....|....|..:.|:.|..|:.||:.:.|...::|||:||.||
  Fly    73 DIYPDLTGLSLVLEYQPDTLYNRLKSEVNPLSRQQVRKFAHQMFKGIAYLHEAGLMHRDIKPANL 137

Human   133 LINRNGELKLADFGLARAFGIP---VRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAE 194
            ||:....||:|||||||.: .|   .|.||.:|.|.|||.|::|||::.|.|.:|||:|||:.||
  Fly   138 LISDTDMLKIADFGLARLY-FPEDESRLYSPQVSTRWYRAPEILFGSQKYGTGVDMWAAGCVVAE 201

Human   195 LANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKP--YP---------MYPATTSL 248
            :.. |.|||.|....:||..|.|.||:|...|||.:|.||||..  :|         ::|:.|..
  Fly   202 MLR-GVPLFAGTTDIEQLAIIIRTLGSPRLNQWPELTSLPDYSKIRFPNSVGIHWDNLFPSCTHA 265

Human   249 VNVVPKLNATGRDLLQNLLKCNPVQRISAEE 279
            |.:         :|:.||:..||..|:.|.|
  Fly   266 VEI---------NLVSNLVVYNPKNRLKASE 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDK5NP_004926.1 STKc_CDK5 3..286 CDD:143344 112/291 (38%)
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 112/291 (38%)
S_TKc 9..288 CDD:214567 112/290 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.