DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDK4 and msn

DIOPT Version :9

Sequence 1:NP_000066.1 Gene:CDK4 / 1019 HGNCID:1773 Length:303 Species:Homo sapiens
Sequence 2:NP_524679.3 Gene:msn / 44030 FlyBaseID:FBgn0010909 Length:1504 Species:Drosophila melanogaster


Alignment Length:305 Identity:80/305 - (26%)
Similarity:137/305 - (44%) Gaps:48/305 - (15%)


- Green bases have known domain annotations that are detailed below.


Human     6 YEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPN 70
            :|.:..:|.|.||.|||.|...:|...|:|.:.|.........|.|:.:::.:..|.:..:....
  Fly    32 FELIEVVGNGTYGQVYKGRHTKTGQLAAIKVMDVTEDEEEEIKLEINVLKKYSNHRNIATYYGAF 96

Human    71 VVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPP-PGLPAETIKDLMRQFLRGLDFLHAN 134
            :.:       |...::.::.||.|:......|.|.|:.. ..|..|.|..:.|:.||||.:||:|
  Fly    97 IKK-------SPPGKDDQLWLVMEYCGAGSVTDLVKSTKGQSLKEEWIAYICREILRGLSYLHSN 154

Human   135 CIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALT-----PVVVTLWYRAPEVLL-----QS 189
            .::|||:|.:|:|:|....|||.|||:    |.|:..|     ..:.|.::.||||:.     .:
  Fly   155 KVIHRDIKGQNVLLTDNAEVKLVDFGV----SAQLDRTIGRRNTFIGTPYWMAPEVIACDENPDA 215

Human   190 TYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGP 254
            ||....|:||:|....||...:|..|   :...:..:|               .:||.: |||  
  Fly   216 TYDNRSDLWSLGITALEMAESQPPLC---DLHPMRALF---------------LIPRNS-PPR-- 259

Human   255 RPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDE 299
              ::|.....:..|  .:..:|..:.|:|......|:|.:: ||:
  Fly   260 --LKSKKWSKKFHG--FIDTVLVKDYHQRPYTENLLKHGFI-KDQ 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDK4NP_000066.1 PKc_like 5..295 CDD:389743 78/299 (26%)
Required for binding D-type cyclins 50..56 1/5 (20%)
msnNP_524679.3 STKc_myosinIII_N_like 25..296 CDD:270785 78/299 (26%)
S_TKc 32..296 CDD:214567 78/299 (26%)
CNH 1183..1484 CDD:214481
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.