DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDK4 and Cdk2

DIOPT Version :9

Sequence 1:NP_000066.1 Gene:CDK4 / 1019 HGNCID:1773 Length:303 Species:Homo sapiens
Sequence 2:NP_001163666.1 Gene:Cdk2 / 42453 FlyBaseID:FBgn0004107 Length:314 Species:Drosophila melanogaster


Alignment Length:301 Identity:131/301 - (43%)
Similarity:185/301 - (61%) Gaps:22/301 - (7%)


- Green bases have known domain annotations that are detailed below.


Human     6 YEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPN 70
            ::...:||.|.||.|||||...:|..||||.:|:.   |...|:|.:.:||::||:.|   :|||
  Fly     8 FQRAEKIGEGTYGIVYKARSNSTGQDVALKKIRLE---GETEGVPSTAIREISLLKNL---KHPN 66

Human    71 VVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANC 135
            ||:|.||..:..     .:.::||:::.||:..:||......| :.||..|.|.|..:.|.|.|.
  Fly    67 VVQLFDVVISGN-----NLYMIFEYLNMDLKKLMDKKKDVFTP-QLIKSYMHQILDAVGFCHTNR 125

Human   136 IVHRDLKPENILVTSGGTVKLADFGLARIYSYQM-ALTPVVVTLWYRAPEVLLQST-YATPVDMW 198
            |:||||||:|:||.:.|.:|||||||||.::..| |.|..||||||||||:||.:. |:|.||:|
  Fly   126 ILHRDLKPQNLLVDTAGKIKLADFGLARAFNVPMRAYTHEVVTLWYRAPEILLGTKFYSTGVDIW 190

Human   199 SVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPE 263
            |:||||:||..|:.||.|:||.|||.:||..:..|.|.:||....||  .|..:.||...:.:|:
  Fly   191 SLGCIFSEMIMRRSLFPGDSEIDQLYRIFRTLSTPDETNWPGVTQLP--DFKTKFPRWEGTNMPQ 253

Human   264 --MEESGAQLLLEMLTFNPHKRISAFRALQHSYL----HKD 298
              .|....:|::.||.::|:.||||..||||:|.    |.|
  Fly   254 PITEHEAHELIMSMLCYDPNLRISAKDALQHAYFRNVQHVD 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDK4NP_000066.1 PKc_like 5..295 CDD:389743 128/292 (44%)
Required for binding D-type cyclins 50..56 1/5 (20%)
Cdk2NP_001163666.1 PLN00009 5..293 CDD:177649 129/298 (43%)
STKc_CDK1_CdkB_like 8..287 CDD:270829 128/292 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.