DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDK4 and Eip63E

DIOPT Version :9

Sequence 1:NP_000066.1 Gene:CDK4 / 1019 HGNCID:1773 Length:303 Species:Homo sapiens
Sequence 2:NP_001261373.1 Gene:Eip63E / 38433 FlyBaseID:FBgn0005640 Length:538 Species:Drosophila melanogaster


Alignment Length:304 Identity:122/304 - (40%)
Similarity:166/304 - (54%) Gaps:35/304 - (11%)


- Green bases have known domain annotations that are detailed below.


Human     6 YEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPN 70
            |..:..:|.|:|.||||.....:...||||.:|:....|.    |.:.:||.:||:.|   :|.|
  Fly   205 YVKLEPLGEGSYATVYKGFSKLTYQRVALKEIRLQEEEGA----PFTAIREASLLKEL---KHSN 262

Human    71 VVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANC 135
            :|.|.|:..|..|     :|.|||:|:.||..|::| .|.||....::..:.|.||||.:.|...
  Fly   263 IVTLHDIVHTRET-----LTFVFEYVNTDLSQYMEK-HPGGLDHRNVRLFLFQLLRGLSYCHKRR 321

Human   136 IVHRDLKPENILVTSGGTVKLADFGLAR-------IYSYQMALTPVVVTLWYRAPEVLLQST-YA 192
            ::|||:||:|:|::..|.:|||||||||       .||::      |||||||.|:|||.|| |:
  Fly   322 VLHRDVKPQNLLISDCGELKLADFGLARAKSVPSHTYSHE------VVTLWYRPPDVLLGSTEYS 380

Human   193 TPVDMWSVGCIFAEMFRRKPLFCGNSEA-DQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPR---- 252
            |.:|||.|||||.||....|.|.|..:. |||.|||.|:|.|.||.||.....| |..|.:    
  Fly   381 TSLDMWGVGCIFVEMVTGMPTFPGIRDTYDQLDKIFKLLGTPTEDTWPGVTHFP-GYKPHKLGFY 444

Human   253 GPRPVQSVVPEMEE--SGAQLLLEMLTFNPHKRISAFRALQHSY 294
            .||.:....|.:.:  .|..:....|..||.:|:.|..||||.|
  Fly   445 RPRKLGHNFPRLYDIIEGETIANGFLQLNPEQRLGADDALQHPY 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDK4NP_000066.1 PKc_like 5..295 CDD:389743 122/304 (40%)
Required for binding D-type cyclins 50..56 1/5 (20%)
Eip63ENP_001261373.1 PLN00009 203..492 CDD:177649 122/304 (40%)
STKc_PCTAIRE_like 204..489 CDD:270835 122/304 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.