DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDK4 and Cdk4

DIOPT Version :9

Sequence 1:NP_000066.1 Gene:CDK4 / 1019 HGNCID:1773 Length:303 Species:Homo sapiens
Sequence 2:NP_001286493.1 Gene:Cdk4 / 36854 FlyBaseID:FBgn0016131 Length:317 Species:Drosophila melanogaster


Alignment Length:293 Identity:139/293 - (47%)
Similarity:195/293 - (66%) Gaps:3/293 - (1%)


- Green bases have known domain annotations that are detailed below.


Human     6 YEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPN 70
            |:.:..||.|||||||:|||..:|:.||||.||:   .....|:|:||:||::||::|.|..|.|
  Fly    26 YQELNIIGEGAYGTVYRARDVITGNIVALKKVRI---SLNENGVPMSTLREISLLKQLNASNHAN 87

Human    71 VVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANC 135
            :|:|.:||.....|.::.:.||||||:|||...:|:.|..|:...||:.|.|:.|.|:||||::.
  Fly    88 IVKLYEVCQFLERDGQLLILLVFEHVEQDLSDLIDRLPKSGMSPPTIQRLSRELLTGVDFLHSHR 152

Human   136 IVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSV 200
            |:||||||:|:||:|.|.:|:||||||:.|..:|.||.||||||||||||||...|.:.||:||.
  Fly   153 IIHRDLKPQNLLVSSQGHLKIADFGLAKTYGSEMKLTSVVVTLWYRAPEVLLAQPYNSTVDIWSA 217

Human   201 GCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEME 265
            .||..|||.|:.||.|.||.:||.:||:|.|.|.|..||:.:|:....||.|.|:..:...|.:.
  Fly   218 ACIIFEMFNRRALFPGTSEKNQLDRIFELTGRPTEQQWPQTISVALEHFPQRHPKRPKDFCPHLC 282

Human   266 ESGAQLLLEMLTFNPHKRISAFRALQHSYLHKD 298
            :....||.:||:::.|.|.||...|:|.|..::
  Fly   283 KYADDLLNKMLSYDLHLRPSALACLEHDYFQQE 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDK4NP_000066.1 PKc_like 5..295 CDD:389743 138/288 (48%)
Required for binding D-type cyclins 50..56 3/5 (60%)
Cdk4NP_001286493.1 STKc_CDK4_6_like 26..312 CDD:270831 138/288 (48%)
S_TKc 26..312 CDD:214567 138/288 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 278 1.000 Domainoid score I1720
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 280 1.000 Inparanoid score I2907
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D419040at33208
OrthoFinder 1 1.000 - - FOG0004605
OrthoInspector 1 1.000 - - otm41504
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24056
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5120
SonicParanoid 1 1.000 - - X2222
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.960

Return to query results.
Submit another query.