DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ALYREF and CG6961

DIOPT Version :9

Sequence 1:NP_005773.3 Gene:ALYREF / 10189 HGNCID:19071 Length:264 Species:Homo sapiens
Sequence 2:NP_573325.1 Gene:CG6961 / 32869 FlyBaseID:FBgn0030959 Length:474 Species:Drosophila melanogaster


Alignment Length:213 Identity:58/213 - (27%)
Similarity:84/213 - (39%) Gaps:52/213 - (24%)


- Green bases have known domain annotations that are detailed below.


Human     1 MPDS--APAMADKMDMSLDDIIKLNRSQRGGRGGGRGRGRAGSQGGRGGGAQAAARVNRGGGPIR 63
            :|:|  :.....|.|..:...|..|.::|...|||   |.:.|..|......|||       |.:
  Fly   292 LPESLRSRLFVGKRDPHISHGIYANENRRKAVGGG---GGSDSDSGTDSDGDAAA-------PSK 346

Human    64 NRPAIARGAAGGGGRNRPAPYS-RPKQLPDKWQHDLFDSGFGGGAGVETGGKLLVSNLDFGVSDA 127
            |:            |..|:|.| |.....|                   |.:||||||...|:.|
  Fly   347 NK------------RRSPSPLSLRTSNTKD-------------------GYRLLVSNLHTNVTTA 380

Human   128 DIQELFAEFGTLKKAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQLVTSQI 192
            ||:|||::.|.:      ||......|||:|.::....|.||:..|:....|.:||:..||... 
  Fly   381 DIRELFSDIGPV------YDARVVRPGTAEVIYKSLEHAEKAVDTYHHRQFDDQPMHCVLVNPH- 438

Human   193 DAQRRPAQSVNRGGMTRN 210
             :.||.....:...:|.|
  Fly   439 -SSRRSVHKASSRTVTTN 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ALYREFNP_005773.3 FYTT 4..>23 CDD:284488 4/20 (20%)
RRM <114..>210 CDD:223796 32/95 (34%)
RRM_THOC4 114..187 CDD:241124 27/72 (38%)
CG6961NP_573325.1 RRM 256..>443 CDD:223796 55/199 (28%)
RRM_SKAR 366..434 CDD:241125 27/73 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0533
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.