DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amfrb and sip3

DIOPT Version :9

Sequence 1:XP_005169066.1 Gene:amfrb / 101884807 ZFINID:ZDB-GENE-130530-643 Length:459 Species:Danio rerio
Sequence 2:NP_001263152.1 Gene:sip3 / 43747 FlyBaseID:FBgn0039875 Length:626 Species:Drosophila melanogaster


Alignment Length:335 Identity:87/335 - (25%)
Similarity:149/335 - (44%) Gaps:67/335 - (20%)


- Green bases have known domain annotations that are detailed below.


Zfish    69 TTGSLCMWVLVNTLCCFLLLMGKCIQLVVFGDLRINEKQNLKDKTWNFLFNKLIFLFGV----LN 129
            |..:..|.|:.......:.:.||.:..:..|.||..|.::|.::.| :...:....|.|    .|
  Fly    35 TKSNASMGVIYIQFFVIVFMFGKLLSKIFLGTLRAAEFEHLLERFW-YALTETCLAFTVFRDDFN 98

Zfish   130 VRTEREMAMWCLCFSALLFLQLLAQLCKDRFEFLSSSPSSTALGSHMHLLLVLMCLFVSSGGLTI 194
            .|       :...|:.||||:....|.::|.:|:..||   .||...|:.:         |.|..
  Fly    99 PR-------FVALFTVLLFLKSFHWLAEERVDFMERSP---VLGWLFHIRV---------GSLLT 144

Zfish   195 ICVLLGFSFGMHTLSFMAV-----------ECLMVSVYVNHSILRYAIHLYDLMCDSSWEGKEVF 248
            :..:|.:...:|..:...|           |..::...:..:.::|.:|..::..|:.||.|.||
  Fly   145 VLGILDYVLLIHAYNSTLVRGPTVQLVFGFEYAILLTVIASTAIKYVLHAAEMRTDTPWENKAVF 209

Zfish   249 IYYTDFVMEMGILLLDMMHHINMLLYGNVWFSVADLFILTHIRFLAKEM---QRKLFQHKNYMH- 309
            :.||:.|:.:          |.::||        .||::...:..|..|   :...|..:|:.. 
  Fly   210 LLYTELVIGL----------IKVVLY--------ILFVVIMAKIYALPMFVFRPMFFTIRNFRKA 256

Zfish   310 IYDV---------MDTRFSMATMEELASRDDRCVICWEKMYT-AYKLPCGHLFHKSCLRSWLEQN 364
            :.||         |:|.:..||.|||...|:.|:||.|.|.. :.||||||:||.:|||||.::.
  Fly   257 LNDVIMSRRAIRNMNTLYPDATPEELRQSDNICIICREDMVNHSKKLPCGHIFHTTCLRSWFQRQ 321

Zfish   365 MSCPTCRMSV 374
            .:|||||:::
  Fly   322 QTCPTCRLNI 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amfrbXP_005169066.1 HRD1 77..>403 CDD:227568 85/327 (26%)
zf-RING_2 331..371 CDD:290367 21/40 (53%)
sip3NP_001263152.1 HRD1 20..>365 CDD:227568 87/335 (26%)
zf-RING_2 287..328 CDD:290367 21/40 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56438
OrthoDB 1 1.010 - - D271732at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.