DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LHFPL2 and CG3770

DIOPT Version :9

Sequence 1:NP_005770.1 Gene:LHFPL2 / 10184 HGNCID:6588 Length:228 Species:Homo sapiens
Sequence 2:NP_001286864.1 Gene:CG3770 / 37991 FlyBaseID:FBgn0035085 Length:219 Species:Drosophila melanogaster


Alignment Length:233 Identity:72/233 - (30%)
Similarity:118/233 - (50%) Gaps:21/233 - (9%)


- Green bases have known domain annotations that are detailed below.


Human     1 MCHVIVTCRSMLWTLLSIVVAFAELIAFMSADWLIGKARSRGGVEPAGPGGGSPEPYHPTLGIYA 65
            ||:||:|..|::|.|.|:|......:|.::..||:|.|:        |....:...:..::|||.
  Fly     1 MCYVIITIASLVWFLCSLVADMLFAVALVTPRWLVGPAQ--------GTDSTASSHHQSSVGIYT 57

Human    66 RC--IRNPGVQHFQRDTLCGPY----AESFGEIASGFWQATAIFLAVGIFILCMVALVSVFTMCV 124
            ||  ::..|.|       ||.:    ..:...:....|:|...|:.:|..:|.:..::::.|.|.
  Fly    58 RCKVMQEGGFQ-------CGRFDLDGLATDSSVYPNEWKAAMFFVMLGFSLLSVTVILTLITCCR 115

Human   125 QSIMKKSIFNVCGLLQGIAGLFLILGLILYPAGWGCQKAIDYCGHYASAYKPGDCSLGWAFYTAI 189
            ||...|||.|:....|.:||:.::|||.|:|.||...:....||..|..:.|.|||:|.:||..|
  Fly   116 QSACGKSIHNMTACAQVVAGICMMLGLFLHPMGWRANRIQRLCGMDAEPFYPADCSIGVSFYCGI 180

Human   190 GGTVLTFICAVFSAQAEIATSSDKVQEEIEEGKNLICL 227
            .|.:|||..|..|.:||.:....:|:..:|.|..|:|:
  Fly   181 IGVLLTFTAAGISLKAESSNMRTRVRRRVEAGSKLVCI 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LHFPL2NP_005770.1 L_HMGIC_fpl 9..204 CDD:287244 60/200 (30%)
CG3770NP_001286864.1 L_HGMIC_fpl 10..195 CDD:287244 60/199 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148232
Domainoid 1 1.000 103 1.000 Domainoid score I6803
eggNOG 1 0.900 - - E1_KOG4026
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I4645
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49708
OrthoDB 1 1.010 - - D1431349at2759
OrthoFinder 1 1.000 - - FOG0006026
OrthoInspector 1 1.000 - - oto89848
orthoMCL 1 0.900 - - OOG6_109429
Panther 1 1.100 - - LDO PTHR12489
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5780
SonicParanoid 1 1.000 - - X4322
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.