DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDK3 and Cdk1

DIOPT Version :9

Sequence 1:NP_001249.1 Gene:CDK3 / 1018 HGNCID:1772 Length:305 Species:Homo sapiens
Sequence 2:NP_062169.1 Gene:Cdk1 / 54237 RGDID:2319 Length:297 Species:Rattus norvegicus


Alignment Length:287 Identity:194/287 - (67%)
Similarity:232/287 - (80%) Gaps:1/287 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MDMFQKVEKIGEGTYGVVYKAKNRETGQLVALKKIRLDLEMEGVPSTAIREISLLKELKHPNIVR 65
            |:.:.|:|||||||||||||.::|.|||:||:|||||:.|.|||||||||||||||||:|||||.
  Rat     1 MEDYIKIEKIGEGTYGVVYKGRHRTTGQIVAMKKIRLESEEEGVPSTAIREISLLKELRHPNIVS 65

Human    66 LLDVVHNERKLYLVFEFLSQDLKKYMDS-TPGSELPLHLIKSYLFQLLQGVSFCHSHRVIHRDLK 129
            |.||:..:.:|||:|||||.|||||:|| .||..:...|:||||:|:|||:.||||.||:|||||
  Rat    66 LQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQFMDSSLVKSYLYQILQGIVFCHSRRVLHRDLK 130

Human   130 PQNLLINELGAIKLADFGLARAFGVPLRTYTHEVVTLWYRAPEILLGSKFYTTAVDIWSIGCIFA 194
            ||||||::.|.|||||||||||||:|:|.|||||||||||:||:||||..|:|.|||||||.|||
  Rat   131 PQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGTIFA 195

Human   195 EMVTRKALFPGDSEIDQLFRIFRMLGTPSEDTWPGVTQLPDYKGSFPKWTRKGLEEIVPNLEPEG 259
            |:.|:|.||.|||||||||||||.||||:.:.||.|..|.|||.:||||....|...|.||:..|
  Rat   196 ELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENG 260

Human   260 RDLLMQLLQYDPSQRITAKTALAHPYF 286
            .|||.::|.|||::||:.|.||.||||
  Rat   261 LDLLSKMLVYDPAKRISGKMALKHPYF 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDK3NP_001249.1 PLN00009 1..293 CDD:177649 194/287 (68%)
STKc_CDK2_3 3..286 CDD:270844 191/283 (67%)
Cdk1NP_062169.1 STKc_CDK1_euk 3..287 CDD:270845 191/283 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
HGNC 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 1 1.000 - - FOG0000411
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100334
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X960
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.