DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDK3 and Cdk4

DIOPT Version :9

Sequence 1:NP_001249.1 Gene:CDK3 / 1018 HGNCID:1772 Length:305 Species:Homo sapiens
Sequence 2:NP_001286493.1 Gene:Cdk4 / 36854 FlyBaseID:FBgn0016131 Length:317 Species:Drosophila melanogaster


Alignment Length:296 Identity:136/296 - (45%)
Similarity:180/296 - (60%) Gaps:13/296 - (4%)


- Green bases have known domain annotations that are detailed below.


Human     4 FQKVEKIGEGTYGVVYKAKNRETGQLVALKKIRLDLEMEGVPSTAIREISLLKEL---KHPNIVR 65
            :|::..||||.||.||:|::..||.:|||||:|:.|...|||.:.:|||||||:|   .|.|||:
  Fly    26 YQELNIIGEGAYGTVYRARDVITGNIVALKKVRISLNENGVPMSTLREISLLKQLNASNHANIVK 90

Human    66 LLDVVH-----NERKLYLVFEFLSQDLKKYMDSTPGSELPLHLIKSYLFQLLQGVSFCHSHRVIH 125
            |.:|..     .:..:.||||.:.|||...:|..|.|.:....|:....:||.||.|.||||:||
  Fly    91 LYEVCQFLERDGQLLILLVFEHVEQDLSDLIDRLPKSGMSPPTIQRLSRELLTGVDFLHSHRIIH 155

Human   126 RDLKPQNLLINELGAIKLADFGLARAFGVPLRTYTHEVVTLWYRAPEILLGSKFYTTAVDIWSIG 190
            |||||||||::..|.:|:||||||:.:|..:: .|..||||||||||:||... |.:.|||||..
  Fly   156 RDLKPQNLLVSSQGHLKIADFGLAKTYGSEMK-LTSVVVTLWYRAPEVLLAQP-YNSTVDIWSAA 218

Human   191 CIFAEMVTRKALFPGDSEIDQLFRIFRMLGTPSEDTWPGVTQLPDYKGSFPKWTRKGLEEIVPNL 255
            ||..||..|:|||||.||.:||.|||.:.|.|:|..||....:.  ...||:...|..::..|:|
  Fly   219 CIIFEMFNRRALFPGTSEKNQLDRIFELTGRPTEQQWPQTISVA--LEHFPQRHPKRPKDFCPHL 281

Human   256 EPEGRDLLMQLLQYDPSQRITAKTALAHPYFSSPEP 291
            .....|||.::|.||...|.:|...|.|.||.. ||
  Fly   282 CKYADDLLNKMLSYDLHLRPSALACLEHDYFQQ-EP 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDK3NP_001249.1 PLN00009 1..293 CDD:177649 136/296 (46%)
STKc_CDK2_3 3..286 CDD:270844 132/289 (46%)
Cdk4NP_001286493.1 STKc_CDK4_6_like 26..312 CDD:270831 132/289 (46%)
S_TKc 26..312 CDD:214567 132/289 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.