DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RBM7 and NGR1

DIOPT Version :9

Sequence 1:NP_001272974.1 Gene:RBM7 / 10179 HGNCID:9904 Length:267 Species:Homo sapiens
Sequence 2:NP_009771.3 Gene:NGR1 / 852513 SGDID:S000000416 Length:672 Species:Saccharomyces cerevisiae


Alignment Length:224 Identity:47/224 - (20%)
Similarity:95/224 - (42%) Gaps:22/224 - (9%)


- Green bases have known domain annotations that are detailed below.


Human    11 TLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKPKQFAFVNFKHEVSVPYAMNLLNGIKL 75
            |:|||.|..|.||..|..||...||::.|:||..|:     ..||.|:..:....::..|.|..:
Yeast   361 TVFVGGLVPKTTEFQLRSLFKPFGPILNVRIPNGKN-----CGFVKFEKRIDAEASIQGLQGFIV 420

Human    76 YGRPIKIQF-RSGSSHAPQDVSLSYPQHHVGNSSPTSTSPSSRYERTMDNMTSSAQIIQRSFSSP 139
            .|.||::.: |..||:|..:.::.....::.::...:.|.:|..:.:...:...|:..:|.|...
Yeast   421 GGSPIRLSWGRPSSSNAKTNSTIMGASQYMSSNGLRAPSAASSVDNSKQILEQYAEDKRRLFLHQ 485

Human   140 ENFQRQAVMNSALRQMSYGGKFGSSPLDQSGFSPSVQSHSHSFNQSSSSQWRQGTPSSQRKVRMN 204
            :..|:|        |....|.|....:..:.:        :::|.....:.:.|:.|....::.:
Yeast   486 QQQQQQ--------QQQQDGNFSMEQMAHNNY--------YNYNNYDYHRNKNGSHSDLVNLQRS 534

Human   205 SYPYLADRHYSREQRYTDHGSDHHYRGKR 233
            :.||:.:.......:|:......|..|.:
Yeast   535 NVPYMQEDGALYPHQYSSPSYSLHPTGNQ 563

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RBM7NP_001272974.1 RRM <9..>84 CDD:223796 25/72 (35%)
RRM_RBM7 9..83 CDD:241036 25/71 (35%)
ZCCHC8 binding. /evidence=ECO:0000269|PubMed:27905398, ECO:0007744|PDB:5LXR, ECO:0007744|PDB:5LXY 25..35 3/9 (33%)
ZCCHC8 binding. /evidence=ECO:0000269|PubMed:27905398, ECO:0007744|PDB:5LXR, ECO:0007744|PDB:5LXY 59..76 2/16 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..267 8/71 (11%)
NGR1NP_009771.3 RRM1_NGR1_NAM8_like 35..180 CDD:410023
RRM2_NGR1_NAM8_like 191..270 CDD:410025
RRM <308..526 CDD:223796 41/185 (22%)
RRM3_NGR1_NAM8_like 359..430 CDD:409782 25/73 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.