| Sequence 1: | NP_001272974.1 | Gene: | RBM7 / 10179 | HGNCID: | 9904 | Length: | 267 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_731825.1 | Gene: | sqd / 41666 | FlyBaseID: | FBgn0263396 | Length: | 344 | Species: | Drosophila melanogaster |
| Alignment Length: | 50 | Identity: | 18/50 - (36%) |
|---|---|---|---|
| Similarity: | 31/50 - (62%) | Gaps: | 1/50 - (2%) |
- Green bases have known domain annotations that are detailed below.
|
Human 12 LFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKD-GKPKQFAFVNFKHE 60 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| RBM7 | NP_001272974.1 | RRM_RBM7 | 9..83 | CDD:410005 | 17/49 (35%) |
| ZCCHC8 binding. /evidence=ECO:0000269|PubMed:27905398, ECO:0007744|PDB:5LXR, ECO:0007744|PDB:5LXY | 25..35 | 2/9 (22%) | |||
| ZCCHC8 binding. /evidence=ECO:0000269|PubMed:27905398, ECO:0007744|PDB:5LXR, ECO:0007744|PDB:5LXY | 59..76 | 0/1 (0%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 163..267 | ||||
| sqd | NP_731825.1 | RRM1_hnRNPA_hnRNPD_like | 58..129 | CDD:409763 | |
| RRM2_hnRNPD_like | 137..211 | CDD:240775 | 17/49 (35%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||