DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RBM7 and TBPH

DIOPT Version :10

Sequence 1:NP_001272974.1 Gene:RBM7 / 10179 HGNCID:9904 Length:267 Species:Homo sapiens
Sequence 2:NP_477400.1 Gene:TBPH / 37781 FlyBaseID:FBgn0025790 Length:531 Species:Drosophila melanogaster


Alignment Length:309 Identity:61/309 - (19%)
Similarity:99/309 - (32%) Gaps:107/309 - (34%)


- Green bases have known domain annotations that are detailed below.


Human    12 LFVGNLETKVTEELLFELFHQAGPVIKVKIPKD-KDGKPKQFAFVNF------------KH---- 59
            |.|..|..|.|||.|.|.|...|.|:..:|.|| |.|:.|.|.||.|            :|    
  Fly   109 LIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVLTNRHLIDG 173

Human    60 ---EVSVPYAMNL----------------LNGIKL------YG--------RPIK---------- 81
               ||.||.:..:                :|...|      :|        ||.:          
  Fly   174 RWCEVKVPNSKGMGHQVPCKVFVGRCTEDINSDDLREYFSKFGEVTDVFIPRPFRAFSFVTFLDP 238

Human    82 --IQFRSGSSHAPQDVSLSYPQHHVGNSSPTSTSPSSRYERTMDNMTSSAQIIQRSFSSPENFQR 144
              .|...|..|..:.||:     ||.|::|.:            ....:.|:...:::|..:|. 
  Fly   239 DVAQSLCGEDHIIKGVSV-----HVSNAAPKA------------EQNRNQQVQSYNYNSANSFG- 285

Human   145 QAVMNSALRQMSYGGKFGSSPLDQSGFSPSVQSHSHSFNQSSSSQWRQGTPSSQRKVRMNSYPYL 209
               |:|...|.::             .:|....|....||.::.........:...:....|. :
  Fly   286 ---MHSYHPQGNH-------------MNPGRNGHHRGNNQHNAHGGENAIVPNNHNIGTAGYG-M 333

Human   210 ADRHYSREQ--RYTDHGSDHHYRGKRDDFFYEDRNHDDWSHDYDNRRDS 256
            ...:|....  .|.::|.:|...|        :.|..|....|::|:.:
  Fly   334 GGNNYGGNSGGGYHNNGGNHSSGG--------NTNRQDGGSQYNSRQSN 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RBM7NP_001272974.1 RRM_RBM7 9..83 CDD:410005 32/132 (24%)
ZCCHC8 binding. /evidence=ECO:0000269|PubMed:27905398, ECO:0007744|PDB:5LXR, ECO:0007744|PDB:5LXY 25..35 3/9 (33%)
ZCCHC8 binding. /evidence=ECO:0000269|PubMed:27905398, ECO:0007744|PDB:5LXR, ECO:0007744|PDB:5LXY 59..76 7/45 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..267 14/96 (15%)
TBPHNP_477400.1 TDP43_N 3..78 CDD:465833
RRM1_TDP43 108..181 CDD:409760 25/71 (35%)
RRM2_TDP43 192..261 CDD:409761 12/73 (16%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.