DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RBM7 and tsu

DIOPT Version :10

Sequence 1:NP_001272974.1 Gene:RBM7 / 10179 HGNCID:9904 Length:267 Species:Homo sapiens
Sequence 2:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster


Alignment Length:74 Identity:18/74 - (24%)
Similarity:36/74 - (48%) Gaps:1/74 - (1%)


- Green bases have known domain annotations that are detailed below.


Human    12 LFVGNLETKVTEELLFELFHQAGPVIKVKIPKD-KDGKPKQFAFVNFKHEVSVPYAMNLLNGIKL 75
            |||.::..:..|:.:.|.|...|.:..:.:..| :.|..|.:|.|.::.......|...|||.::
  Fly    75 LFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEI 139

Human    76 YGRPIKIQF 84
            .|:.|::.:
  Fly   140 MGQTIQVDW 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RBM7NP_001272974.1 RRM_RBM7 9..83 CDD:410005 18/71 (25%)
ZCCHC8 binding. /evidence=ECO:0000269|PubMed:27905398, ECO:0007744|PDB:5LXR, ECO:0007744|PDB:5LXY 25..35 2/9 (22%)
ZCCHC8 binding. /evidence=ECO:0000269|PubMed:27905398, ECO:0007744|PDB:5LXR, ECO:0007744|PDB:5LXY 59..76 4/16 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..267
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:445520 3/4 (75%)
RRM_RBM8 67..154 CDD:409762 18/74 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.