DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RBM7 and Pabp2

DIOPT Version :10

Sequence 1:NP_001272974.1 Gene:RBM7 / 10179 HGNCID:9904 Length:267 Species:Homo sapiens
Sequence 2:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster


Alignment Length:74 Identity:26/74 - (35%)
Similarity:41/74 - (55%) Gaps:2/74 - (2%)


- Green bases have known domain annotations that are detailed below.


Human    10 RTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDK-DGKPKQFAFVNFKHEVSVPYAMNLLNGI 73
            |:::|||::...:.|.|...||..|.:.:|.|..:| ||.||.||::.|..:..|..|: .:|..
  Fly    96 RSVYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETAL-AMNET 159

Human    74 KLYGRPIKI 82
            ...||.||:
  Fly   160 LFRGRQIKV 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RBM7NP_001272974.1 RRM_RBM7 9..83 CDD:410005 26/74 (35%)
ZCCHC8 binding. /evidence=ECO:0000269|PubMed:27905398, ECO:0007744|PDB:5LXR, ECO:0007744|PDB:5LXY 25..35 3/9 (33%)
ZCCHC8 binding. /evidence=ECO:0000269|PubMed:27905398, ECO:0007744|PDB:5LXR, ECO:0007744|PDB:5LXY 59..76 3/16 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..267
Pabp2NP_476902.1 DNA_pol_phi <3..68 CDD:461488
RRM_II_PABPN1 97..172 CDD:409966 25/73 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.