DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RBM7 and CG10466

DIOPT Version :10

Sequence 1:NP_001272974.1 Gene:RBM7 / 10179 HGNCID:9904 Length:267 Species:Homo sapiens
Sequence 2:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster


Alignment Length:72 Identity:24/72 - (33%)
Similarity:41/72 - (56%) Gaps:1/72 - (1%)


- Green bases have known domain annotations that are detailed below.


Human    12 LFVGNLETKVTEELLFELFHQAGPVIKVKIPKD-KDGKPKQFAFVNFKHEVSVPYAMNLLNGIKL 75
            :||......:||..|..:|.|.|.|:.:.:.:| |.||.|.|.|:.::.:.|...|::.|||||:
  Fly    36 IFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYEDQRSTVLAVDNLNGIKI 100

Human    76 YGRPIKI 82
            ..|.:::
  Fly   101 LDRTLRV 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RBM7NP_001272974.1 RRM_RBM7 9..83 CDD:410005 24/72 (33%)
ZCCHC8 binding. /evidence=ECO:0000269|PubMed:27905398, ECO:0007744|PDB:5LXR, ECO:0007744|PDB:5LXY 25..35 3/9 (33%)
ZCCHC8 binding. /evidence=ECO:0000269|PubMed:27905398, ECO:0007744|PDB:5LXR, ECO:0007744|PDB:5LXY 59..76 7/16 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..267
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 24/72 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.