| Sequence 1: | NP_001272974.1 | Gene: | RBM7 / 10179 | HGNCID: | 9904 | Length: | 267 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_573324.1 | Gene: | CG18259 / 32866 | FlyBaseID: | FBgn0030956 | Length: | 474 | Species: | Drosophila melanogaster |
| Alignment Length: | 30 | Identity: | 13/30 - (43%) |
|---|---|---|---|
| Similarity: | 16/30 - (53%) | Gaps: | 0/30 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Human 12 LFVGNLETKVTEELLFELFHQAGPVIKVKI 41 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| RBM7 | NP_001272974.1 | RRM_RBM7 | 9..83 | CDD:410005 | 13/30 (43%) |
| ZCCHC8 binding. /evidence=ECO:0000269|PubMed:27905398, ECO:0007744|PDB:5LXR, ECO:0007744|PDB:5LXY | 25..35 | 3/9 (33%) | |||
| ZCCHC8 binding. /evidence=ECO:0000269|PubMed:27905398, ECO:0007744|PDB:5LXR, ECO:0007744|PDB:5LXY | 59..76 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 163..267 | ||||
| CG18259 | NP_573324.1 | RRM_SKAR | 366..434 | CDD:410082 | 13/30 (43%) |
| Blue background indicates that the domain is not in the aligned region. | |||||