DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42764 and PRY2

DIOPT Version :9

Sequence 1:NP_001189140.1 Gene:CG42764 / 10178963 FlyBaseID:FBgn0261832 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_012938.3 Gene:PRY2 / 853882 SGDID:S000001721 Length:329 Species:Saccharomyces cerevisiae


Alignment Length:171 Identity:41/171 - (23%)
Similarity:60/171 - (35%) Gaps:61/171 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 HNDHRR--------TWVVPELIESDELSHDAEEYAIHLATLNIPDQILYETAKDRNIRVDHLDYP 83
            ||..|.        ||       ||.|:..|:.||               .:.|.:..:.|...|
Yeast   200 HNTKRALHKDTGSLTW-------SDTLATYAQNYA---------------DSYDCSGNLVHSGGP 242

  Fly    84 LSEPENDFYTENIC-EFIRNECVYYWASEGAASY-----GIAKERRTKVEQSLADKFSAITWKST 142
                    |.||:. .:.....|..|.:| ..||     |.::.         |..|:.:.||.|
Yeast   243 --------YGENLALGYGTTGSVDAWYNE-ITSYDYSNPGFSES---------AGHFTQVVWKGT 289

  Fly   143 TEMGVGWAPKDRSKKGGR--KILVVRYSPAGNQPGEYAENI 181
            :|:|.|     ....||.  ..::..|..|||..||:|:|:
Yeast   290 SEVGCG-----LKSCGGEWGDYIICSYKAAGNVIGEFADNV 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42764NP_001189140.1 SCP 22..172 CDD:294090 35/160 (22%)
PRY2NP_012938.3 CAP_PRY1-like 191..319 CDD:349403 37/163 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.