DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42764 and AT1G50050

DIOPT Version :9

Sequence 1:NP_001189140.1 Gene:CG42764 / 10178963 FlyBaseID:FBgn0261832 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_175427.1 Gene:AT1G50050 / 841429 AraportID:AT1G50050 Length:226 Species:Arabidopsis thaliana


Alignment Length:152 Identity:28/152 - (18%)
Similarity:54/152 - (35%) Gaps:35/152 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FLFFLAFRPCLGYNVIRSEAYDAHNDHRRTWVVPELIESDELSHDAEEYAIHLATLNIPDQIL-- 66
            ||..:|    :.:.|:.:.|.:|..|:..|             |:.....:.:|.: :.|.::  
plant     8 FLIIVA----ISFLVLATNAQNAQQDYLNT-------------HNTARAQVGVANV-VWDTVVAA 54

  Fly    67 YET--AKDRNIRVDHLDYPLSEPENDFYTENICE-----FIRNECVYYWASEGAASYGIAKERRT 124
            |.|  |..|.:     |..|:......|.||:..     |.....|..|.:| ...|........
plant    55 YATNYANARKV-----DCSLTPSTGGSYGENLANGNNALFTGVAAVNLWVNE-KPYYNYTANACI 113

  Fly   125 KVEQSLADKFSAITWKSTTEMG 146
            ..:|  ...::.:.|.::.::|
plant   114 GAQQ--CKHYTQVVWSNSVKIG 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42764NP_001189140.1 SCP 22..172 CDD:294090 24/134 (18%)
AT1G50050NP_175427.1 SCP 27..151 CDD:294090 22/129 (17%)
Radical_SAM <155..185 CDD:302752
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.