DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42764 and CRISPLD1

DIOPT Version :9

Sequence 1:NP_001189140.1 Gene:CG42764 / 10178963 FlyBaseID:FBgn0261832 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_113649.1 Gene:CRISPLD1 / 83690 HGNCID:18206 Length:500 Species:Homo sapiens


Alignment Length:194 Identity:37/194 - (19%)
Similarity:51/194 - (26%) Gaps:88/194 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 YNVIRSEAY-DAHNDHRRTWVVPELIESDELSHDAEEYA---------------------IHLAT 58
            :|.:||:.| .|.|....||.|       ||...||.:|                     .|...
Human    69 HNKLRSQVYPTASNMEYMTWDV-------ELERSAESWAESCLWEHGPASLLPSIGQNLGAHWGR 126

  Fly    59 LNIPD---QILYETAKDRNIRVDHLDYPLSEPENDFYTENICEFIRNECVYYWASEGAASYGIAK 120
            ...|.   |..|:..||       ..||.....|.:     |.|                     
Human   127 YRPPTFHVQSWYDEVKD-------FSYPYEHECNPY-----CPF--------------------- 158

  Fly   121 ERRTKVEQSLADKFSAITWKSTTEMGVG---------WA---PKDRSKKGGRKILVVRYSPAGN 172
                :....:...::.:.|.::..:|..         |.   ||       ...||..|||.||
Human   159 ----RCSGPVCTHYTQVVWATSNRIGCAINLCHNMNIWGQIWPK-------AVYLVCNYSPKGN 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42764NP_001189140.1 SCP 22..172 CDD:294090 32/186 (17%)
CRISPLD1NP_113649.1 SCP_euk 63..207 CDD:240180 32/188 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 254..281
LCCL 291..375 CDD:128866
LCCL 392..483 CDD:128866
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.