DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42764 and AT5G26130

DIOPT Version :9

Sequence 1:NP_001189140.1 Gene:CG42764 / 10178963 FlyBaseID:FBgn0261832 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_197985.2 Gene:AT5G26130 / 832682 AraportID:AT5G26130 Length:166 Species:Arabidopsis thaliana


Alignment Length:179 Identity:38/179 - (21%)
Similarity:64/179 - (35%) Gaps:32/179 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LFLFFLAFRPCLGYNVIRSEAYDAHNDHRRTWVVPELIESDELSHDAEEYAIHLATLNIPDQILY 67
            :.:.||||...|.......:..|.||..|....||.:    :....||:||.:           |
plant    14 VIVLFLAFAVPLKAQDQPQDYLDEHNRARTQVGVPPM----KWHAGAEQYAWN-----------Y 63

  Fly    68 ETAKDRNIRVDHLDYPLSEPENDFYTENIC----EFIRNECVYYWASEGAASYGIAKERRTKVEQ 128
            ...:..:..:.|.:      .|..|.||:.    .....|.|..|.:| .:.|..|....:..:|
plant    64 AQQRKGDCSLTHSN------SNGLYGENLAWSGGALSGAEAVKLWVNE-KSDYIYASNTCSDGKQ 121

  Fly   129 SLADKFSAITWKSTTEMGVGWAPKDRSKKGGRKILVVRYSPAGNQPGEY 177
              ...::.:.|:::..:|   ..|.:...|| ..:...|.|.||..|.:
plant   122 --CGHYTQVVWRTSEWVG---CAKVKCDNGG-TFVTCNYYPPGNYRGRW 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42764NP_001189140.1 SCP 22..172 CDD:294090 30/153 (20%)
AT5G26130NP_197985.2 CAP_PR-1 31..166 CDD:349400 33/162 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.