DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42764 and AT4G31470

DIOPT Version :10

Sequence 1:NP_001189140.1 Gene:CG42764 / 10178963 FlyBaseID:FBgn0261832 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_194875.1 Gene:AT4G31470 / 829274 AraportID:AT4G31470 Length:185 Species:Arabidopsis thaliana


Alignment Length:176 Identity:40/176 - (22%)
Similarity:63/176 - (35%) Gaps:51/176 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LGYNVIRSEAYDAHNDHRRTWVVPELIESDELSHDAEEYAIHLATLNIPDQILYETAKDRNIRVD 78
            |..|.|:.:....||..|....:|.|..|:.|:                   ||.:...|..|.|
plant    45 LARNTIQQQFLRPHNILRAKLRLPPLKWSNSLA-------------------LYASRWARTRRGD 90

  Fly    79 ----HLDYPLSEPENDFYTENIC-----EFIRNECVYYWASEGAASYGIAKERRTKVEQSLAD-- 132
                |...|        |.||:.     .:...:.|..||||  ..|   .:|||...::..|  
plant    91 CKLIHSGGP--------YGENLFWGSGKGWTPRDAVAAWASE--MKY---YDRRTSHCKANGDCL 142

  Fly   133 KFSAITWKSTTEMG--VGWAPKDRSKKGGRKILVVRYSPAGNQPGE 176
            .::.:.||.::.:|  :.:.      |.|...::..|.|.||..|:
plant   143 HYTQLVWKKSSRIGCAISFC------KTGDTFIICNYDPPGNIVGQ 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42764NP_001189140.1 CAP 18..172 CDD:412178 35/166 (21%)
AT4G31470NP_194875.1 CAP_PR-1 51..185 CDD:349400 37/170 (22%)

Return to query results.
Submit another query.