DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42764 and AT4G30320

DIOPT Version :10

Sequence 1:NP_001189140.1 Gene:CG42764 / 10178963 FlyBaseID:FBgn0261832 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_194761.1 Gene:AT4G30320 / 829155 AraportID:AT4G30320 Length:161 Species:Arabidopsis thaliana


Alignment Length:71 Identity:20/71 - (28%)
Similarity:28/71 - (39%) Gaps:7/71 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 NECVYYWASEGAASYGIAKERRTKVEQSLADKFSAITWKSTTEMGVGWAPKDRSKKGGRKILVVR 166
            ::..|.|.|| |.||..   |.......:...::.|.||:|.::|....   ....||...|...
plant    91 SQAAYGWLSE-ARSYNY---RSNSCNSEMCGHYTQIVWKNTQKIGCAHV---ICNGGGGVFLTCN 148

  Fly   167 YSPAGN 172
            |.|.||
plant   149 YDPPGN 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42764NP_001189140.1 CAP 18..172 CDD:412178 18/69 (26%)
AT4G30320NP_194761.1 CAP_PR-1 27..161 CDD:349400 20/71 (28%)

Return to query results.
Submit another query.