DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42764 and PR-1-LIKE

DIOPT Version :9

Sequence 1:NP_001189140.1 Gene:CG42764 / 10178963 FlyBaseID:FBgn0261832 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_179589.1 Gene:PR-1-LIKE / 816518 AraportID:AT2G19990 Length:176 Species:Arabidopsis thaliana


Alignment Length:174 Identity:31/174 - (17%)
Similarity:53/174 - (30%) Gaps:63/174 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 EAYDAHNDHRRTWVVPELIESDELSHDAEEYAIHLATLNIPDQILYETAKD-----------RNI 75
            |....||..|....|..::.::.|:..|:.||             :|.|:|           .|:
plant    44 ETLVVHNKARAMVGVGPMVWNETLATYAQSYA-------------HERARDCAMKHSLGPFGENL 95

  Fly    76 RVD--------HLDYPLSEPENDFYTENICEFIRNECVYYWASEGAASYGIAKERRTKVEQSLAD 132
            ...        ..:|.::|.||..|..|.|           ..:|...:                
plant    96 AAGWGTMSGPVATEYWMTEKENYDYDSNTC-----------GGDGVCGH---------------- 133

  Fly   133 KFSAITWKSTTEMGVGWAPKDRSKKGGRKILVVRYSPAGNQPGE 176
             ::.|.|:.:..:|   ....|.|......::..|.|.||..|:
plant   134 -YTQIVWRDSVRLG---CASVRCKNDEYIWVICSYDPPGNYIGQ 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42764NP_001189140.1 SCP 22..172 CDD:294090 28/168 (17%)
PR-1-LIKENP_179589.1 CAP_PR-1 42..176 CDD:349400 31/174 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.