powered by:
Protein Alignment CG42764 and AT2G19970
DIOPT Version :9
Sequence 1: | NP_001189140.1 |
Gene: | CG42764 / 10178963 |
FlyBaseID: | FBgn0261832 |
Length: | 232 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_179587.1 |
Gene: | AT2G19970 / 816516 |
AraportID: | AT2G19970 |
Length: | 177 |
Species: | Arabidopsis thaliana |
Alignment Length: | 68 |
Identity: | 18/68 - (26%) |
Similarity: | 25/68 - (36%) |
Gaps: | 21/68 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 114 ASYGIAKERRTKVEQSLADKFSAITWKSTTEMGVGWAPKDRSKKGGRKILVVRYSPAGNQPGEYA 178
|:.|:|..:..|...:.|.||: :|..|.| |..||...:..|.|.
plant 47 AAVGVAPLKWNKTVAAYAQKFA-----------------NRQAKAG----VCDYSSMRHSDGPYG 90
Fly 179 ENI 181
|||
plant 91 ENI 93
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG42764 | NP_001189140.1 |
SCP |
22..172 |
CDD:294090 |
13/57 (23%) |
AT2G19970 | NP_179587.1 |
CAP_PR-1 |
35..177 |
CDD:349400 |
18/68 (26%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1528782at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.