DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42764 and Glipr2

DIOPT Version :9

Sequence 1:NP_001189140.1 Gene:CG42764 / 10178963 FlyBaseID:FBgn0261832 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_006238202.1 Gene:Glipr2 / 679819 RGDID:1583669 Length:170 Species:Rattus norvegicus


Alignment Length:174 Identity:45/174 - (25%)
Similarity:71/174 - (40%) Gaps:48/174 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SEAYDAHNDHRRTWVVPELIESDELSHDAEEYAIHLATLNIPDQILYETAKDRNIRVDHLDYPLS 85
            :|...|||::|....||.|....:|:.:|::|:..||:..|               :.|      
  Rat    27 NEVLKAHNEYRAKHGVPPLKLCKKLNQEAQQYSEALASTRI---------------LKH------ 70

  Fly    86 EPENDFYTENICEFIRNEC--VYYWASEGAASYGIAKERRTKVEQ---------SLADKFSAITW 139
            .||:.          |.:|  ...|||.......:|....::::.         |....|:|:.|
  Rat    71 SPESS----------RGQCGENLAWASYDQTGKEVADRWYSEIKSYNFQQPGFTSGTGHFTAMVW 125

  Fly   140 KSTTEMGVGWAPKDRSKKGGRKILVVRYSPAGN--QPGEYAENI 181
            |:|.::|||.|    |...|...:|.||.||||  ..|.:.||:
  Rat   126 KNTKKIGVGKA----SASDGSSFVVARYFPAGNIVNQGFFEENV 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42764NP_001189140.1 SCP 22..172 CDD:294090 40/160 (25%)
Glipr2XP_006238202.1 SCP_GAPR-1_like 24..155 CDD:240182 41/162 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.