DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42764 and Crisp1

DIOPT Version :9

Sequence 1:NP_001189140.1 Gene:CG42764 / 10178963 FlyBaseID:FBgn0261832 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001034482.2 Gene:Crisp1 / 654517 RGDID:1590757 Length:254 Species:Rattus norvegicus


Alignment Length:227 Identity:51/227 - (22%)
Similarity:75/227 - (33%) Gaps:63/227 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LLFLFFLA-----FRPCLG----------YNVI--------RSEAYDAHNDHRRTWVVP--ELIE 41
            |:.|.|||     |.|.:.          ||.:        :.|..|.||..||....|  .:::
  Rat     5 LILLLFLAATLTVFVPVVTLRHLKLDRALYNQLITESQTEPQEEIVDTHNAFRRNVSPPARNMLK 69

  Fly    42 SDELSHDAEEYAIHLATLNIPD-----QILYETAKDRNIRVDHLDYPLSEPENDFYTENICEFIR 101
            ....|..||...|.....:..|     :.|..|....|:.::  :||.|       ..|:.|...
  Rat    70 MSWSSAAAENARILARYCDKSDSDSLERRLPNTFCGENMHME--NYPSS-------WSNVIEIWY 125

  Fly   102 NECVYYWASEGAASYGIAKERRTKVEQSLADKFSAITWKSTTEMGVGWAPKDRSKKGGRKILVVR 166
            ||..|:       .||........:|   ...::.:.|.|:..:|...| ..|.:|....:.|..
  Rat   126 NESKYF-------KYGEWPSTDDDIE---TYHYTQMVWASSYLIGCDVA-SCRRQKAATYLYVCH 179

  Fly   167 YSPAGNQPGEYAENIGDTEFLEYFKMPTREDP 198
            |...||..        ||     ..||.:|.|
  Rat   180 YCHEGNSQ--------DT-----LNMPYKEGP 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42764NP_001189140.1 SCP 22..172 CDD:294090 34/156 (22%)
Crisp1NP_001034482.2 SCP 46..182 CDD:294090 34/155 (22%)
Crisp 200..254 CDD:285731
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.