DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42764 and Crisp3

DIOPT Version :9

Sequence 1:NP_001189140.1 Gene:CG42764 / 10178963 FlyBaseID:FBgn0261832 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_074050.1 Gene:Crisp3 / 64827 RGDID:619846 Length:246 Species:Rattus norvegicus


Alignment Length:259 Identity:59/259 - (22%)
Similarity:87/259 - (33%) Gaps:93/259 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLFLFFLA--FRPCLGYNV-----------------IRSEAYDAHNDHRRTWVVPELIESD--- 43
            ::|.|.|||  ..|.|..:.                 ::.|..:.||..||| |.|.  .||   
  Rat     3 LMLVLLFLAAVLPPSLLQDTTDEWDRDLENLSTTKLSVQEEIINKHNQLRRT-VSPS--GSDLLR 64

  Fly    44 -ELSHD----AEEYAIHLATLNIPDQILYETAK-DRNIRVDHLDYPLSEPE--NDFYTENICEFI 100
             |..||    |:::|......:.|.|....|.| ..|:.:  .:||.|...  .|:|.|:: :|:
  Rat    65 VEWDHDAYVNAQKWANRCIYNHSPLQHRTTTLKCGENLFM--ANYPASWSSVIQDWYDESL-DFV 126

  Fly   101 RNECVYYWASEGAASYGIA-KERRTKVEQSLADKFSAITWKST--TEMGVGWAPKDRSKKGGRKI 162
                           :|.. |:...||     ..::.:.|.||  ...||...|....|    ..
  Rat   127 ---------------FGFGPKKVGVKV-----GHYTQVVWNSTFLVACGVAECPDQPLK----YF 167

  Fly   163 LVVRYSPAGNQPG----------------------------EYAENIGDTEFLEYFKMPTREDP 198
            .|..|.|.||..|                            ||.:|..:...|:  ||.:.:||
  Rat   168 YVCHYCPGGNYVGRLYSPYTEGEPCDSCPGNCEDGLCTNSCEYEDNYSNCGDLK--KMVSCDDP 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42764NP_001189140.1 SCP 22..172 CDD:294090 41/163 (25%)
Crisp3NP_074050.1 SCP_CRISP 39..174 CDD:240183 40/164 (24%)
Crisp 192..246 CDD:285731 8/40 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.