DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42764 and crispl

DIOPT Version :9

Sequence 1:NP_001189140.1 Gene:CG42764 / 10178963 FlyBaseID:FBgn0261832 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001025526.1 Gene:crispl / 594930 XenbaseID:XB-GENE-5768874 Length:314 Species:Xenopus tropicalis


Alignment Length:176 Identity:42/176 - (23%)
Similarity:65/176 - (36%) Gaps:44/176 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RSEAYDAHNDHRRTWVVP-----ELIESDELSHDAEEYAIHLATLNIPDQILYETAK-DRNIRVD 78
            |....:.||:.||....|     :::.||..:..|.::|      |...|  |.:.| :|.|   
 Frog   108 RQSILNVHNELRRNANPPPSNMLKMVWSDLAAKSAAKWA------NSCKQ--YHSLKPERTI--- 161

  Fly    79 HLDYP-LSEPENDFYT------ENICEFIRNECVYYWASEGAASYGIAKERRTKVEQSLADKFSA 136
                | .|..||.|..      |::.....:|...:...:||...|:         |.|  .|:.
 Frog   162 ----PGFSCGENLFMASYKASWEDVIRAFYSEIEDFLYGKGAKEVGL---------QIL--HFTQ 211

  Fly   137 ITWKSTTEMGVGWAPKDRSKKGGRKILVVRYSPAGNQPGEYAENIG 182
            :.|.|:..:|...|....:........|..|:||||    |. |:|
 Frog   212 VMWFSSWLVGCAAAQCPITDHSLEFYFVCHYAPAGN----YG-NVG 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42764NP_001189140.1 SCP 22..172 CDD:294090 36/162 (22%)
crisplNP_001025526.1 CAP_CRISP 106..245 CDD:349402 35/162 (22%)
Crisp 261..314 CDD:369954
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.