DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42764 and Glipr1l3

DIOPT Version :9

Sequence 1:NP_001189140.1 Gene:CG42764 / 10178963 FlyBaseID:FBgn0261832 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001360960.1 Gene:Glipr1l3 / 544736 MGIID:3620621 Length:236 Species:Mus musculus


Alignment Length:201 Identity:41/201 - (20%)
Similarity:66/201 - (32%) Gaps:83/201 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 HNDHRRTWVVPELIESDELSHDAEEYAIHLATLNIPDQILYETAK--DRNIRVDH---------- 79
            ||:.||. |.|...:.:::               |.||.|.:.||  .|..::.|          
Mouse    49 HNELRRK-VQPPAADMNQV---------------IWDQKLAKLAKAWTRECKLGHNPCTSKQYGC 97

  Fly    80 -LDYPL-----------SEPE---NDFYTENI-CEFIRNECVYYWASEGAASYGIAKERRTKVEQ 128
             |||..           ::||   |::|.||. ..|:.|.|                       .
Mouse    98 LLDYDFIGENIYLGEIETQPEDVVNNWYNENTDYNFVDNTC-----------------------S 139

  Fly   129 SLADKFSAITWKSTTEMGVGWAPKDRSKKGGRKILVVRYSPAGNQPGEYAENIGDTEFLEYFKMP 193
            .:...::.:.|..|.::|...:......:....:.|..|||.||             ||::  .|
Mouse   140 KICRNYTQLVWAKTFKIGCAVSNCPNLTRYSAGLFVCNYSPTGN-------------FLDF--RP 189

  Fly   194 TRE-DP 198
            .|: ||
Mouse   190 YRKGDP 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42764NP_001189140.1 SCP 22..172 CDD:294090 33/172 (19%)
Glipr1l3NP_001360960.1 CAP 40..182 CDD:381818 33/171 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.