Sequence 1: | NP_001189140.1 | Gene: | CG42764 / 10178963 | FlyBaseID: | FBgn0261832 | Length: | 232 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001360960.1 | Gene: | Glipr1l3 / 544736 | MGIID: | 3620621 | Length: | 236 | Species: | Mus musculus |
Alignment Length: | 201 | Identity: | 41/201 - (20%) |
---|---|---|---|
Similarity: | 66/201 - (32%) | Gaps: | 83/201 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 27 HNDHRRTWVVPELIESDELSHDAEEYAIHLATLNIPDQILYETAK--DRNIRVDH---------- 79
Fly 80 -LDYPL-----------SEPE---NDFYTENI-CEFIRNECVYYWASEGAASYGIAKERRTKVEQ 128
Fly 129 SLADKFSAITWKSTTEMGVGWAPKDRSKKGGRKILVVRYSPAGNQPGEYAENIGDTEFLEYFKMP 193
Fly 194 TRE-DP 198 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG42764 | NP_001189140.1 | SCP | 22..172 | CDD:294090 | 33/172 (19%) |
Glipr1l3 | NP_001360960.1 | CAP | 40..182 | CDD:381818 | 33/171 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1528782at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |