DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42764 and Glipr1l1

DIOPT Version :9

Sequence 1:NP_001189140.1 Gene:CG42764 / 10178963 FlyBaseID:FBgn0261832 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_002729836.2 Gene:Glipr1l1 / 503139 RGDID:1563000 Length:235 Species:Rattus norvegicus


Alignment Length:227 Identity:48/227 - (21%)
Similarity:75/227 - (33%) Gaps:73/227 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LLFLFFLAFR-----------------PCLGYNVIRSEAYDAHNDHRRTWVVPELIESDELSHDA 49
            |:||:.||..                 |.:.....::...::||:.||. |.|.....::||.  
  Rat     7 LIFLWTLALYLVASRLPKAFGKVLPRVPTINDPEFKNGFLNSHNEARRK-VQPPASNMNQLSW-- 68

  Fly    50 EEYAIHLATLNIPDQILYETAKD--RNIRVDH-----------LDYPLSEPENDFYTENI----C 97
                         |:.|.:.||.  |..:..|           .||       |:..|||    .
  Rat    69 -------------DKSLAKLAKSWTRECKFSHNPCTSKRHGCTKDY-------DYIGENIYLGKI 113

  Fly    98 EFIRNECVYYWASEGAASYGIAKERRTKVEQSLADKFSAITWKSTTEMG--VGWAPKDRSKKGGR 160
            :....:.|:.|.:| ...|.......||.    ...::.:.|..|.::|  :...|.......| 
  Rat   114 DARPEDVVFSWYNE-TKDYNFDDNTCTKT----CGHYTQVVWAKTLKIGCAISNCPHLTGYSAG- 172

  Fly   161 KILVVRYSPAGN----QP---GEYAENIGDTE 185
             :.|..|.||||    :|   ||.....|:.|
  Rat   173 -LFVCNYVPAGNFQGSKPYIKGEPCSMCGEKE 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42764NP_001189140.1 SCP 22..172 CDD:294090 35/168 (21%)
Glipr1l1XP_002729836.2 SCP 40..181 CDD:294090 33/170 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.