DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42764 and crisp1.3

DIOPT Version :9

Sequence 1:NP_001189140.1 Gene:CG42764 / 10178963 FlyBaseID:FBgn0261832 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001008204.1 Gene:crisp1.3 / 493566 XenbaseID:XB-GENE-951048 Length:240 Species:Xenopus tropicalis


Alignment Length:168 Identity:34/168 - (20%)
Similarity:59/168 - (35%) Gaps:55/168 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DAHNDHRRTWVVP------ELIESDELSHDAEEYAIHLATLNIPD-----------QILYETAKD 72
            :|||::||. ..|      :::.:.:.:.:|..:|...:..:.|.           :.||..:  
 Frog    40 NAHNNYRRN-ASPSARNMLKMVWNKDAAINAASWAATCSESHSPSDKRTIPGFGCGENLYMAS-- 101

  Fly    73 RNIRVDHLDYPLSEPENDFYTENICEFIRNECVYYWASE-GAASYGIAKERRTKVEQSLADKFSA 136
                     ||.|               ..|.|..|.|| ....||:.    .|....:...::.
 Frog   102 ---------YPAS---------------WEEAVKGWYSEYNDFQYGVG----PKSPGLVTGHYTQ 138

  Fly   137 ITWKSTTEMG--VGWAPKDRSKKGGRKILVVRYSPAGN 172
            :.|.::..:|  |.:.||...|    ...|.:|.||||
 Frog   139 VMWYNSYMVGCSVSYCPKSPYK----YFYVCQYCPAGN 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42764NP_001189140.1 SCP 22..172 CDD:294090 32/166 (19%)
crisp1.3NP_001008204.1 CAP_CRISP 33..170 CDD:349402 30/164 (18%)
Crisp 187..240 CDD:369954
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.