DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42764 and Ag5r

DIOPT Version :9

Sequence 1:NP_001189140.1 Gene:CG42764 / 10178963 FlyBaseID:FBgn0261832 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001245671.1 Gene:Ag5r / 44631 FlyBaseID:FBgn0015010 Length:256 Species:Drosophila melanogaster


Alignment Length:94 Identity:17/94 - (18%)
Similarity:28/94 - (29%) Gaps:27/94 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLFLFFLAFRPCLGYNVIRSEAYDAHN---DHRRTW----------VVPELIESDELSHDAEEY 52
            :::|...|||......:..:.......|   |:...|          :.....|.|.|.....||
  Fly     5 VIIFSLSLAFGIASATDYCKKSCGSTKNLGCDNNGAWASSCPSDATLLTLSSAEKDALVARTNEY 69

  Fly    53 AIH--------------LATLNIPDQILY 67
            ..|              :||:...|::.|
  Fly    70 RNHIAGGLNANLSAACRMATIKWNDELAY 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42764NP_001189140.1 SCP 22..172 CDD:294090 13/73 (18%)
Ag5rNP_001245671.1 SCP_euk 59..211 CDD:240180 9/40 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.