DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42764 and CG8483

DIOPT Version :9

Sequence 1:NP_001189140.1 Gene:CG42764 / 10178963 FlyBaseID:FBgn0261832 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster


Alignment Length:159 Identity:38/159 - (23%)
Similarity:65/159 - (40%) Gaps:21/159 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ELIESDELSHDAEEYAIHLATLNIPDQILYETAKDRNIRVDHLDYPLSEPENDFYTENICEFIRN 102
            |::..|||:..|:::|.:....:.|.:.:......:|:.:.....||...:.||.:.        
  Fly    67 EIVWDDELAARAQKWADNCQFRHDPHRTINRFTMGQNLAIIWSTAPLDADDGDFPSR-------- 123

  Fly   103 ECVYYWASE-GAASYGIAKERRTKVEQSLADKFSAITWKSTTEMGVGWAP-KDRSKKGGRKILVV 165
              :..|.:| ...|:|.|...:|       ..:|.:.|..|:.:|.|:|. ||.||.  .|:.|.
  Fly   124 --IQSWFNEVQKYSFGDAWSPKT-------GHYSQLVWGETSLVGCGYAEYKDTSKY--NKLYVC 177

  Fly   166 RYSPAGNQPGEYAENIGDTEFLEYFKMPT 194
            .|.|.||..|.....:|......|...|:
  Fly   178 NYGPGGNVVGYNPYEVGKPSCSTYGMKPS 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42764NP_001189140.1 SCP 22..172 CDD:294090 32/135 (24%)
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 30/131 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.