DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42764 and scpr-C

DIOPT Version :9

Sequence 1:NP_001189140.1 Gene:CG42764 / 10178963 FlyBaseID:FBgn0261832 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001287282.1 Gene:scpr-C / 41348 FlyBaseID:FBgn0037879 Length:262 Species:Drosophila melanogaster


Alignment Length:189 Identity:41/189 - (21%)
Similarity:68/189 - (35%) Gaps:53/189 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VPELIESDELSHDAEEYAIHLATLNI------PDQI----LYETAKDRNIRVDHLDYPLSEPEND 90
            :|:.:...::|. .||.: |||.||:      ||:.    .:..|...|.   ...|..:|.|  
  Fly    79 LPKAVRMAKMSW-CEELS-HLALLNVKTCESLPDKCRSTERFAYAGQNNA---VFQYSGAETE-- 136

  Fly    91 FYTENICEFIRNECVYYWASEGAASYGIAKERRTKVEQSLADKFSAITWKSTTEMG--------- 146
             ||:  .|.|:.:...::|....||..|......::......||:....:..|.:|         
  Fly   137 -YTD--AEIIKEQIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVGCAAVRFSRD 198

  Fly   147 ----------------VG---WAPKDRSKKGGRKILVVRYSPAGNQPGE-YAENIGDTE 185
                            ||   :.|.:::..|.:.    ||..|.:.|.. ||:.|.|.|
  Fly   199 FYNHFVLTCNFATSNIVGQPVYTPGEKATTGCKN----RYGAAYDYPNLCYAKEIYDNE 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42764NP_001189140.1 SCP 22..172 CDD:294090 35/173 (20%)
scpr-CNP_001287282.1 SCP_euk 58..210 CDD:240180 28/140 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.