DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42764 and CG8072

DIOPT Version :9

Sequence 1:NP_001189140.1 Gene:CG42764 / 10178963 FlyBaseID:FBgn0261832 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster


Alignment Length:98 Identity:23/98 - (23%)
Similarity:37/98 - (37%) Gaps:27/98 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CLGYNVIRSEAY------DAHNDHRR------------TWVVPELIESDELSHDAEEYAIHLATL 59
            ||.::.:.:.||      ..||.:|:            ...:|||:..:.||..| ||.:....:
  Fly    48 CLRFHGLVNMAYFREYLLGLHNGYRQEVASNLFVDLPPAQKMPELVWDNYLSVVA-EYHLKRCQM 111

  Fly    60 NIPDQILYETAKDRNIRVDHLDYPLSEPENDFY 92
            ::||        |..:..|....|......|||
  Fly   112 DLPD--------DSCVATDDFSEPHFNYAEDFY 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42764NP_001189140.1 SCP 22..172 CDD:294090 21/89 (24%)
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 19/85 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.